CAZyme Information: MGYG000002455_00830

Basic Information

• Species: Bacteroides cellulosilyticus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cellulosilyticus
• CAZyme ID: MGYG000002455_00830
• CAZy Family: CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
940	MGYG000002455_3|CGC3	104548.66	5.1597

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002455	6974062	Isolate	United States	North America

• Gene Location: Start: 121544; End: 124366 Strand: -

Full Sequence      

MKNLSIRHGKSSGNKSVLLLTVLALGTGFSSLSAQTNAASDQITAQPAADRIVPFRLSEQ
GVVRPVEWGLDTAWEDEGNIRRGQGFMETVDIVRVSFRPTDPIVDGDLGADQKEHIQTRL
GLLGFVSPKPKLAINSDHPKIDDSYKGNAQAWAQMMDLHTRYFQDAGYEVISVAPFNEPD
YTYTGQGTREDFHKIAVELRANPRFKNIRICGGNTLNCDEALPWYNYLKEQLDEGNTHQL
AGEFNGYAAFYETVRKDGKMAMNDEMHNVMEAMVGLEYGLQTGIWWGSAEYARGEFCKIS
RGGERLAYTEHRPNWTAASVYRSKDGSKVQAFGGVSERQAKTTTYRFVSKEKDVFYDGYG
PQREFYLEMPGGNSYQDDEQRNAERVVNITWGEDIQPVIDGQYVLINRSTQRAVEITQGN
TAEGTNVKTGKFDASKAYQRWYVRPVSSRIGGDFSYFCITSPINGMSFDIWNWSLEDGGN
IAIYGASNGSNQQWALEYAGDGWFYIRSRHSALYLEEGEEAFNVQQGTKKGSNDERLQWR
LIPAPASKIEIKSLATPTGLTTEGQSASVLLRWNKQSDATGYTVLRSETSGGAYEIIARN
VKETSFVDHKALAGKSYYYTVKANDNCLNSSPKSQEVTATITDVHALVAHYAFDGDLLDE
TENLNHGASLKKAMFTDGKINKAVQLNGSTEFLQLPTDIANHQNLTVSTWVKWDGGADWQ
RVFDFGSGEDQYMFLTYSSNIQSLRFAMKNGAEEQALETALPSPIRIDNWVHLALTIGDA
EVRIYVNGELAVSSGDITIRPMDIRPCLNYIGRSQFVADPMFKGSIDDFRVYNYELSAED
IKKVAQGESVGIITPQISDDELFIGPLPADQKLQVTYTPAQSSGRVSLSIYNMQGVPVLS
HETAGSGVTTLDVSGLPTGLYLLRLVDNNRSVTRKFAVRH

Enzyme Prediction     

No EC number prediction in MGYG000002455_00830.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13385	Laminin_G_3	4.86e-30	687	842	1	151	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.
pfam14200	RicinB_lectin_2	3.74e-13	437	516	1	74	Ricin-type beta-trefoil lectin domain-like.
TIGR04183	Por_Secre_tail	2.15e-10	866	939	3	72	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.
pfam18962	Por_Secre_tail	4.59e-10	866	936	3	70	Secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber have on average twenty or more copies of this C-terminal domain, associated with sorting to the outer membrane and covalent modification. This domain targets proteins to type IX secretion systems and is secreted then cleaved off by a C-terminal signal peptidease. Based on similarity to other families it is likely that this domain adopts an immunoglobulin like fold.
smart00560	LamGL	1.69e-06	703	838	1	132	LamG-like jellyroll fold domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ60208.1	0.0	1	940	1	940
QUT88791.1	0.0	1	940	1	940
ASB47762.1	2.22e-306	35	938	31	931
APZ45922.1	2.68e-258	23	940	12	930
AUC19784.1	2.68e-258	23	940	12	930

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QVS_A	8.73e-13	649	845	7	220	ChainA, S-layer domain-containing protein [Acetivibrio thermocellus ATCC 27405]
5HON_A	1.08e-10	647	846	5	206	Structureof Domain 4 of AbnA, a GH43 extracellular arabinanase from Geobacillus stearothermophilus, in complex with arabinotriose [Geobacillus stearothermophilus],5HON_B Structure of Domain 4 of AbnA, a GH43 extracellular arabinanase from Geobacillus stearothermophilus, in complex with arabinotriose [Geobacillus stearothermophilus]
5HO0_A	2.56e-10	564	846	566	845	Crystalstructure of AbnA (closed conformation), a GH43 extracellular arabinanase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5HO2_A Crystal structure of AbnA (open conformation), a GH43 extracellular arabinanase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5HOF_A Crystal structure of AbnA, a GH43 extracellular arabinanase from Geobacillus stearothermophilus, in complex with arabinopentaose [Geobacillus stearothermophilus],5HP6_A Structure of AbnA, a GH43 extracellular arabinanase from Geobacillus stearothermophilus (a new conformational state) [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38536	3.01e-07	557	639	933	1015	Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=amyB PE=3 SV=2
P36905	4.84e-07	463	639	849	1016	Amylopullulanase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=apu PE=3 SV=2
P16950	9.82e-06	558	639	933	1014	Amylopullulanase OS=Thermoanaerobacter thermohydrosulfuricus OX=1516 GN=apu PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.006987	0.975428	0.013463	0.003493	0.000395	0.000234

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002455_00830.