CAZyme Information: MGYG000002455_00916

Basic Information

• Species: Bacteroides cellulosilyticus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cellulosilyticus
• CAZyme ID: MGYG000002455_00916
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
755		85971.6	6.2949

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002455	6974062	Isolate	United States	North America

• Gene Location: Start: 244755; End: 247022 Strand: -

Full Sequence      

MKNFCLITLFICFSGLPVWGGGTSEKAVYDLIERVTPGYASQYRLEMIQPENGSDVYEVD
GDGQRIILRGNNAVSLATAFNWYLKYTCHAHVSWFGNQLKLPAKLPQPANKERRIINGKY
RVYMNYCTVSYTAAWWNWERWQQELDYMAMNAINMPLFSVGLDGVWYNTLLRFNFTEEEA
RAFLTGPGHSAWQWMQNIQSYGGPLPKSVIDKHVILGKKILARQLELGMQPIQQGFSGYV
PRELQAKYPQAKISMKRKWCGFDGTAQLDPTDPLFHEMGLAFLEEQDKLFGSYGVYAADP
FHESAPPIDTPEYLTGVGQTIHKLFQTFDAGALWVMQAWSMREDIVKAVPKESLLILDLN
GSKTAANGGWGYPVIAGNLHNFGGRINMHGDLALLASNQYQKAKARYPNVCGSGLFMEAI
EQNPVYYELAFEMPNHADSIPLQAWLAAYAERRYGAKSAAAGKAWMYLLEGPYRQGTNGT
ERSSIVAARPALNVKKSGPNAGLGIPYEPMLVIRAQSQLLKDADKLAFSKPYRFDIVDVQ
RQMMTNLGQLVHKKAAEAFASKDKAAFVLHSGRFLELLRDMDELLYTRSEYSFDRWLTEA
RSWGETKEEKDLMERDATSLVTIWGADGDPRIFDYSWREWAGLINGYYLPRWQKFYTMLQ
GHLDAGTDYQEEGLSLAYGREDFRANDFYNRLAEWELAYVDQTGKARTPVTHGDELVVTR
RLFDKYLKLSREYYADFSGVGEIKEERTYENVGEE

Enzyme Prediction     

No EC number prediction in MGYG000002455_00916.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	63	723	1.5e-200	0.9939668174962293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	2.34e-145	121	434	1	330	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	3.56e-73	445	720	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	3.64e-34	26	106	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ60114.1	0.0	1	755	1	755
QUT88879.1	0.0	1	755	1	755
QDO68352.1	0.0	1	755	1	755
QUT74342.1	0.0	7	755	12	760
QUT48266.1	0.0	26	754	24	752

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	2.84e-118	27	726	8	711	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	1.92e-107	13	667	159	832	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	2.27e-107	13	667	167	840	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	2.29e-106	13	667	182	855	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FNA3	1.83e-117	25	726	46	804	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
P54802	2.84e-117	20	726	19	734	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000358	0.998873	0.000266	0.000165	0.000156	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002455_00916.