CAZyme Information: MGYG000002455_01138

Basic Information

• Species: Bacteroides cellulosilyticus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cellulosilyticus
• CAZyme ID: MGYG000002455_01138
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399		45517.6	6.5002

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002455	6974062	Isolate	United States	North America

• Gene Location: Start: 197927; End: 199126 Strand: -

Full Sequence      

MNRISLKLLTVCGITCFMACTTTQKPKTEKWSERMARSEMKRFPEPWMIEKASKPRWGYT
HGLVVKSMLEEWKHTGDSTYYDYAKIYADSLIDNDGHIRTMKYLSFNIDNVNAGKILFDF
YAQTGDERYKIAMDTLRKQMREQPRTSEGGFWHKLRYPHQMWLDGIFMASPYLAQYGATF
GEPILQDEAVKQILLIARKTYDPATGLYYHGWDESREQKWANPETGCSPNFWSRSIGWYG
AAIVDVLDYLPQETAGRDSVVQILQGLAQAMVKYQDPQSGTWYQVTDQGARKGNYLESSA
TALFVYTLAKSINRGYIGNEYIAPVQKAFDGMVATFTRLEEDGTYTLTNCCAVAGLGGNS
GKYRDGSFEYYIGEPVIENDPKSVGAFILAAIEYERMKE

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	49	396	2.7e-122	0.9849397590361446

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.34e-143	31	398	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.57e-114	21	396	5	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ62142.1	4.81e-294	1	397	1	397
QUT92128.1	3.95e-293	1	397	1	397
QDH55647.1	5.13e-269	1	397	1	397
QUR43125.1	5.13e-269	1	397	1	397
QUT38413.1	7.29e-269	1	399	1	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	2.21e-101	57	397	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	5.46e-94	56	395	38	365	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.26e-93	56	395	28	355	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	1.99e-19	145	397	183	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4Q88_A	1.24e-14	123	396	105	356	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.99e-93	56	395	38	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.42e-47	168	393	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.42e-47	168	393	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	6.17e-17	57	343	29	294	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P9WF04	6.48e-06	162	393	201	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000003	1.000073	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002455_01138.