CAZyme Information: MGYG000002455_02312

Basic Information

• Species: Bacteroides cellulosilyticus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cellulosilyticus
• CAZyme ID: MGYG000002455_02312
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
535	MGYG000002455_9|CGC2	59656.15	4.6634

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002455	6974062	Isolate	United States	North America

• Gene Location: Start: 97867; End: 99474 Strand: -

Full Sequence      

MKLKYYFTLLSLLSFMACSDDSPSTPDTPDQPDVPNSVEKLVTINAGKTYQTITGFGASD
CWNPSYVGKYWTNSREKITELLFSSEIQAGSPKGIGLSMWRVNLGGGTAEQGDASGITDK
SRRAESYLTNDLTLDWNRCEGQRYFLNRAKEFGCESIVLFSNTPPVQYTQNGKGFSNQGG
VSNLKNDCYDDFAAYMGDVAQYYIDKGYPVTHISPVNEPQYNWDGGQEGSGWTNDEVARL
ARELDDALTERNLSTDILLGESGDWEYLYKTKDDANRSNVMSAFFTPGSSAYVGNLNHVK
KLICGHSYWTDGTWDGMRSVRKQVAQAATQYGVDVWQSEWSMLGDNYSNTEFVGYDNATE
MDIAFYMSRVIHNDLTVAGVSSWSYWTSMDVARWGHKNRFLLISLVPGGGINDNNDNIEK
EGTFQPTATLWVLGNYSLFIRPGYQRINMQLTESLNFFGSAWLSPQGDKIVAVFTNMSSK
NVRLSETHEGWSNKATSIRTYTTTNSKKLTEATVSAGESVLLEAESVTTVVYNLK

Enzyme Prediction     

EC	3.2.1.38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	42	531	1.6e-179	0.993801652892562

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	3.34e-130	39	390	1	357	O-Glycosyl hydrolase family 30.
COG5520	XynC	7.77e-17	1	534	1	430	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59966.1	0.0	1	535	1	535
QUT89021.1	0.0	1	535	1	535
BBK87114.1	3.28e-293	36	535	24	520
QUT97738.1	4.04e-293	36	535	39	535
QUT34917.1	5.73e-293	36	535	39	535

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	1.25e-72	39	531	5	495	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
4FMV_A	1.74e-14	42	533	5	387	CrystalStructure Analysis of a GH30 Endoxylanase from Clostridium papyrosolvens C71 [Ruminiclostridium papyrosolvens DSM 2782]
7O0E_A	2.24e-13	42	531	5	446	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	5.76e-13	42	531	12	453	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6M5Z_A	7.03e-13	42	485	25	408	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q76FP5	8.27e-16	42	445	24	383	Endo-beta-1,6-galactanase OS=Hypocrea rufa OX=5547 GN=6GAL PE=1 SV=1
G2Q1N4	2.43e-13	42	531	29	470	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1
Q45070	3.51e-06	42	533	36	421	Glucuronoxylanase XynC OS=Bacillus subtilis (strain 168) OX=224308 GN=xynC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000083	0.077589	0.922233	0.000034	0.000037	0.000031

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002455_02312.