CAZyme Information: MGYG000002455_02336

Basic Information

• Species: Bacteroides cellulosilyticus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cellulosilyticus
• CAZyme ID: MGYG000002455_02336
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000002455_9|CGC3	43326.66	7.5574

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002455	6974062	Isolate	United States	North America

• Gene Location: Start: 150755; End: 151876 Strand: -

Full Sequence      

MRKLIIVGLITFVPIWVSAQKAFKNWPEGVSPKEVGELVSKRFVEVPHPNFNGNPAPPNE
ITYPETCAWFGALRYADITHNKRLLRQLEERFLPIFGPERHLQPLPDHVDHTVFGTIPLQ
LYAQTGKEIYYHMGIWYADEQWKMPRKTKHKEEYQTLLNQGLSWQTRYWIDDMFMISAIQ
SQAFFVTKDRQYIDRAASEMVVYLDKIQRSNGLFYHAEDVPFFWGRGNGWMAAGMTELLG
LLPKDNPNHVRILESYRKMMDTLRQYQKEDGLWGQLVDDKTTWTETSGSAMFTYAMIKGV
KQGWLDEAVYTPVVRKAWIALVGHIDENGDIAGVCEGTNKTNDRQFYLNRRTLLGNMHGQ
APVLWCVNAFLER

Enzyme Prediction     

No EC number prediction in MGYG000002455_02336.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	59	368	1.4e-72	0.9548192771084337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.72e-48	41	366	11	335	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	4.66e-48	63	364	36	347	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89045.1	3.45e-290	1	373	1	373
ALJ59941.1	2.83e-289	1	373	1	373
QIH32537.1	1.87e-165	5	373	4	374
QQT56290.1	2.50e-164	25	373	29	378
QQT33758.1	3.55e-164	25	373	29	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	3.51e-30	169	365	200	405	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	3.35e-22	57	364	35	358	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.42e-21	57	364	25	348	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
5NOA_A	5.08e-20	153	318	145	321	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	7.46e-18	153	318	128	304	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.84e-21	57	364	35	358	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	3.61e-19	169	354	201	403	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
L7P9J4	1.30e-15	137	334	139	343	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	1.75e-15	219	334	225	342	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P0A3U6	2.69e-09	221	364	61	222	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000992	0.998232	0.000198	0.000210	0.000179	0.000170

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002455_02336.