CAZyme Information: MGYG000002455_02383

Basic Information

• Species: Bacteroides cellulosilyticus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cellulosilyticus
• CAZyme ID: MGYG000002455_02383
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368	MGYG000002455_9|CGC4	43207.75	8.4731

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002455	6974062	Isolate	United States	North America

• Gene Location: Start: 216788; End: 217894 Strand: +

Full Sequence      

MYKKVFALLFLLSSFQLLIAQTSLLKNFPEGYTPDEIGRRIAYRFVTEKHALHAGKWIGY
PETFYWNGSLKYAAAAKDKALIKLLQARFEHLFTTEKELLPIKNHVDLNMFGSLPLELYW
VTKDERYKELGLPYADTQWEVPEDAKPSEKEWAEKGYSWQTRLWIDDMYMITIVQTHAYK
VTNDSKYIDRAAKEMVMYLDELQRPNGLFYHAPDVPFYWGRGNGWMAAGMAELLRYLPKK
HKDRPRIMEGYLTMMKSLKEYQNPEGLWNQLLDDPECWTETSGSAMFTFAFITGVKNGWL
DAKEYAPAARKAWMALVTYLTEKNQVREICVGTNKKNDKQYYYDRPRRTGDFHAQGPYLW
CVVALMEK

Enzyme Prediction     

No EC number prediction in MGYG000002455_02383.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	58	365	1.5e-73	0.9548192771084337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	6.71e-51	118	361	84	335	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	3.02e-39	32	368	14	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59885.1	7.17e-285	1	368	1	368
QUT89090.1	7.17e-285	1	368	1	368
QDO68157.1	2.89e-275	1	368	1	368
QDH53377.1	5.33e-232	1	368	1	367
BCA52191.1	1.53e-231	8	368	7	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	1.45e-33	163	360	199	405	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	8.59e-32	54	365	36	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.69e-31	54	365	26	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
5NOA_A	1.67e-24	164	318	158	326	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.72e-24	164	318	141	309	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	4.70e-31	54	365	36	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
T2KPL9	4.66e-19	151	326	141	339	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	1.28e-17	164	342	201	396	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
L7P9J4	1.50e-16	218	316	231	330	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
O31521	2.62e-14	157	345	126	319	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000222	0.999158	0.000169	0.000149	0.000140	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002455_02383.