CAZyme Information: MGYG000002455_02722

Basic Information

• Species: Bacteroides cellulosilyticus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cellulosilyticus
• CAZyme ID: MGYG000002455_02722
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
859	MGYG000002455_11|CGC3	97632.47	5.9771

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002455	6974062	Isolate	United States	North America

• Gene Location: Start: 92241; End: 94820 Strand: -

Full Sequence      

MMRISLKTRIVCLQLCLILASTLQAADKFVSFIREEGTLELVTSQQRSFSILCADEEHKG
VLTAVHNLQEDFYKVADIRPALVADAKQKGSADGQNVRILIGSFDESPFIKQLVKSKKLD
ARELKGKNEKFIITTVKDPVEGIPGEVLLIAGSDKRGTIYGVYELSRQIGVSPWYWWADV
PAERHEELYIKKGVYTDGEPAVKYRGIFINDEWPCMGGWTTERYGGFNSKMYVHVYELLL
RLKANFLWPAMWSAAFYADDPMNSPLADEMGIIIGTSHHEPMARNHQEYARNRKVYGAWN
YQTNKDGIDRFFREGIERMRGKEEVVTIAMRGDGDAPMGPDTDTKLLENIVKEQRRIIAE
VTGKSASKTPQLWALYSEVLEYYDQGMQIPDDVMILLCDDNWGDVRRLPEPGVKRHPGGY
GMYYHVDLHGAPRAYQWLNMTQIQHMWEQLYLTYAYGVDKMWILNVGDLKPNEFPTDFFL
KMAWNPDAFNAGNLMDYTREFCRQQFGNEYADEAARILNLYCKYCARVTAEMLDHKTYNL
QSGEFKAVADEFLALEAHAVRQFALLPENRRDAYKELILFPVQAMANLYEMYCATAVNRQ
LAAENDVRANAWADRVEYCFRRDAELCADYNNNIAGGKWKHMMDQTHIGYTSWDEPKGGN
IMPKVTRVDASRNGNMVMGGYEYEESSGVVVMEAERFATSVQEPGTQWTVIPDLGRTLSG
LSLMPYTKPVSGASLIYQMRLKSDLSGVRVRLILDSTLPFIKGGHSYAIRLDDGEEQIVN
YNSDLTWANCYSKMYPAGAARVIESKVTFPDVTLEAGVHTLTIRPLSPAIVLHKIIVDCG
GDMLGRLNLTESPRTRTLK

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	43	835	9.2e-274	0.9899569583931134

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	198	532	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	1.32e-35	685	841	4	162	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	1.72e-04	99	165	64	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT90767.1	0.0	1	859	1	859
ALJ58215.1	0.0	1	859	1	859
EDV03678.1	0.0	1	859	1	859
EDO10801.1	0.0	21	853	19	841
QRQ55179.1	0.0	21	853	19	841

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	0.0	25	856	30	853	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	2.94e-307	50	856	27	838	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	2.64e-305	50	856	26	837	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	5.67e-176	29	673	5	639	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	2.40e-135	40	660	10	652	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000277	0.999126	0.000165	0.000145	0.000135	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002455_02722.