CAZyme Information: MGYG000002455_03840

Basic Information

• Species: Bacteroides cellulosilyticus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cellulosilyticus
• CAZyme ID: MGYG000002455_03840
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
598	MGYG000002455_18|CGC1	64918.47	4.6045

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002455	6974062	Isolate	United States	North America

• Gene Location: Start: 25314; End: 27110 Strand: +

Full Sequence      

MNKIKAYLLLLTIALSAFAAACSSDDNDPVTPEITISENILANGMSFSKAGGTNTLSVKS
NVTLEVTSNQDWCVVTPAVSASATVFKYTIDVKSNSTTDNRTSVITVKGGNLTETFNVIQ
TATEGLDLETVLFEDISAAGGTITVKVMTNGEPTITINDSWITEKTETRAMVDKTKTFII
AANTGKKRTGTITFILGDLPATTVTVKQLAGGEISSNEIAGEDPWTVAKSLGLGWNLGNQ
LDAHNSGVANETAWGNQKTTQALFDKLAAAGITTVRIPVTWMGHIGDAPGYEIEKAWMDR
VAEVVGYAENAGLNAIVNIHHDGADSEYWLSIKDAAQDETKNTAIKTELKAVWTQIAERF
KDKGNFLAFESMNEIHDGGWGWGDNRNDGGKQYSILNDWNQVFVDAVRAVGGGNSNRFLG
VPGYCTNVALTVSNFKLPTDKVQNRLMVSVHFYDPNEYTLDAKYSEWGHTGAADKKANWG
DEDNVKDVFNSLKTTYIDKGIPVYIGEMGCVSRTTDRAESFRKYYLEYVCKAAKEYGLAP
VYWDNGGTGSGKEESGLFNHATGDYLNNAAEIVEVMKKAIFTEDASYTLQSVYDNAPQ

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	250	546	8e-98	0.9927536231884058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	5.91e-57	242	547	7	270	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	5.51e-25	198	546	10	360	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd14948	BACON	1.32e-15	33	120	1	82	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
cd14948	BACON	1.70e-11	135	208	10	82	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam13004	BACON	1.11e-06	65	120	4	60	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT88430.1	0.0	1	598	1	598
ALJ60576.1	2.05e-287	1	598	1	512
ADY35478.1	6.80e-251	7	598	9	592
AVM57519.1	2.37e-189	126	598	82	563
ADD61911.1	1.82e-184	126	598	4	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WQY_A	8.25e-194	219	582	19	384	ChainA, Cellulase [Phocaeicola salanitronis DSM 18170]
4YHE_A	5.00e-134	230	598	13	386	NativeBacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a],4YHE_B Native Bacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a]
4YHG_A	4.00e-133	230	598	13	386	NativeBacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a],4YHG_B Native Bacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a]
2JEP_A	5.23e-84	216	561	27	377	Nativefamily 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEP_B Native family 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEQ_A Family 5 xyloglucanase from Paenibacillus pabuli in complex with ligand [Paenibacillus pabuli]
6GL2_A	3.84e-63	224	578	14	337	Structureof ZgEngAGH5_4 wild type at 1.2 Angstrom resolution [Zobellia galactanivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O08342	2.04e-76	227	559	43	380	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
Q12647	1.01e-60	227	562	28	347	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1
P28621	3.34e-60	227	559	45	355	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
A7LXT7	7.33e-60	135	577	53	499	Xyloglucan-specific endo-beta-1,4-glucanase BoGH5A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02653 PE=1 SV=1
P28623	9.74e-60	227	580	46	369	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000046	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002455_03840.