CAZyme Information: MGYG000002455_03843

Basic Information

• Species: Bacteroides cellulosilyticus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cellulosilyticus
• CAZyme ID: MGYG000002455_03843
• CAZy Family: GH31
• CAZyme Description: Alpha-xylosidase BoGH31A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
960	MGYG000002455_18|CGC1	110222.32	4.8859

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002455	6974062	Isolate	United States	North America

• Gene Location: Start: 31522; End: 34404 Strand: +

Full Sequence      

MKLKNTSVCLLAGWMLMACSGGGYEKTSNGIIVNVEQQQPTDVRKVKVEVMGEKLIHVSA
TPEKNFSKAESLIIVPQKDKTDFSVEESEDAVSVKTSEVCAIVSKATGEVRFTDASGNLI
LAEDERGRSFQPIEVQGTKAYTVRQVFQSPDDEAFYGLGQHQADEFNYKGKNEELFQYNT
KVSVPFIVSNKNYGILWDSYSLCRFGDPRDYAQLSTVFKLYDKEGKEGALTGTYVPSQKS
TAETLVRREDSVYFEHLKSEDLSKVVNLPEGFPFMGSQVTYEGEIEPMESGRFRFILYYA
GYTKVYIDGELVVPERWRTAWNPNSYKFAVDLKAGKRVPLKIEWIPDGYVSYCGLRALSP
VSAEEQNKQSWWGEMQNEIDYYFVYGEDMDEVISGYRALTGKSQIMPKWAMGYWQSRERY
KTQEEILDALKEFRKRQIPIDNIVLDWSYWPENAWGSHEFDKARFPDPKGMVDSIHALNA
KMMISVWPKFYMITEHYKEFDEKGWMYQQAVKDSIRDWIGPGYIGSFYDAYAEGARKLFW
KQMEDHLYPLGIDAWWMDASEPNVRDCTDLAYRKALCGPTALGPSDQYFNAYALMNAEAI
YDGQRAVDNDKRVFLLTRSGFAGLQRYSTATWSGDIATRWEDMKAQISAGLNFAVSGIPY
WTMDIGGFCVEKRYEDGQKEFNKTGKENADYKEWRELNTRWYQFGAFCPLFRAHGQYPFR
EVWNIAPEGHPAYSSIVYYTKLRYTMMPYIYSLAGMTYFDDYTIMRPLVMDFTADTKVNN
ISDQFMFGPALMAAPVYEYGARTREVYFPATCGWYDFYTGKYMSGGQQLKVDAPYERMPL
YVREGAIVPYGPEMQYSDEKPAEEITLYVYAGKDGEFTLYEDEGVNYNYEKGQYATIPFT
YNDAEGTLTIGDRAGEFPGMLKERTFNVVKVSKDKPQPFDAKAKGVTVKYDGKRQSVSIS

Enzyme Prediction     

EC	3.2.1.177

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	381	848	2.5e-145	0.9976580796252927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01055	Glyco_hydro_31	0.0	382	848	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06591	GH31_xylosidase_XylS	4.12e-172	401	743	1	322	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.
COG1501	YicI	3.70e-167	361	935	217	758	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06603	GH31_GANC_GANAB_alpha	5.40e-77	401	885	1	466	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
cd06598	GH31_transferase_CtsZ	2.47e-71	401	754	1	330	CtsZ (cyclic tetrasaccharide-synthesizing enzyme Z)-like. CtsZ is a bacterial 6-alpha-glucosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsY. CtsZ and CtsY both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsY belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ60579.1	0.0	1	960	1	960
QUT88427.1	0.0	1	960	1	960
QUT37091.1	0.0	1	959	1	960
BBK86686.1	0.0	1	959	1	960
QBJ18686.1	0.0	1	959	1	960

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KMP_A	0.0	4	957	36	975	ChainA, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306],7KNC_A Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306]
5JOU_A	0.0	24	959	27	955	Bacteroidesovatus Xyloglucan PUL GH31 [Bacteroides ovatus],5JOV_A Bacteroides ovatus Xyloglucan PUL GH31 with bound 5FIdoF [Bacteroides ovatus]
2XVG_A	2.95e-309	25	957	50	984	crystalstructure of alpha-xylosidase (GH31) from Cellvibrio japonicus [Cellvibrio japonicus],2XVK_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with 5-fluoro-alpha-D-xylopyranosyl fluoride [Cellvibrio japonicus],2XVL_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with Pentaerythritol propoxylate (5 4 PO OH) [Cellvibrio japonicus]
6JR6_A	1.53e-72	381	949	238	792	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]
6JR8_A	1.87e-71	381	949	238	792	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXT0	0.0	1	959	3	954	Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02646 PE=1 SV=1
Q9P999	2.17e-156	46	953	8	723	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
Q9F234	1.17e-70	379	910	230	737	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
Q01336	2.48e-56	366	715	201	523	Uncharacterized family 31 glucosidase ORF2 (Fragment) OS=Pseudescherichia vulneris OX=566 PE=3 SV=1
B3PEE6	3.62e-50	381	948	234	779	Oligosaccharide 4-alpha-D-glucosyltransferase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=agd31B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000054	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002455_03843.