CAZyme Information: MGYG000002455_05258

Basic Information

• Species: Bacteroides cellulosilyticus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cellulosilyticus
• CAZyme ID: MGYG000002455_05258
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
750	MGYG000002455_40|CGC1	82976.47	6.7502

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002455	6974062	Isolate	United States	North America

• Gene Location: Start: 7430; End: 9682 Strand: +

Full Sequence      

MFRHILYYVTSVFLLLHPYVCYSTDYKPDKETEKRIEALLGKMTLEEKIGQMNQLHCENF
PYLKTETRKGRVGSVMSITDPNIFNEVQRIAVEDSRLGIPLINARDVIHGFKTIFPIPLG
QAASFNPEIAETGARIAATEASAAGIRWTFAPMIDITHDPRWGRIAEGFGEDPLLVSQMG
VAAIKGFQGSSLNHPTSIAACAKHFAGYGASEGGRDYNSTYITERQFRNLYLRPFEAAVN
AGAATLMTAFNDNDGIPSSANPFLLKDVLRNEWNYRGTVVSDWASVSEMIRHGFCEDEKE
AALKATNAGTDIEMVSETYIKHLPQLIKEGKVSMETIDNAVRNILRLKFRLGLFEHPYIA
DQRKETFYRPDFLEAAQTAAEQSAVLLKNERGTLPIQSNIKTILVTGPLADAPHEQLGTW
VFDGDASYSQTPLQALRRISGDSIKVLYAPGLNYSRDTATSQFNKVVELAREADLILAFV
GEEAILSGEAHCLANLNLQGAQSRLLHRLSETGKPLVTVVMAGRPLTIGREVNISDALLY
AFHPGTMGGPALANLLFGKVVPSGKLPVTFPKETGQIPIYYNHTSTGRPASGSEKNIFTI
PVGAEQTSLGNTSFYLDAGKDPLFPFGYGLSYTTFAYSNLQLSSTQYTRNEVIIITFDLT
NTGKTDGTEIAQLYFRDLAASVTRPVKELAAFERIHLKAGETRHIRMELPVKQLSFWNYA
MDYCVEPGKFDLWIGGNSRKGLKATFNITQ

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	93	315	1.5e-72	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	36	748	38	764	beta-glucosidase BglX.
COG1472	BglX	1.02e-112	43	445	1	392	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	2.33e-94	44	347	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	7.78e-76	113	718	112	752	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	7.30e-56	384	632	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT88713.1	0.0	1	750	1	750
ALJ60280.1	0.0	1	750	1	750
AFU63316.1	0.0	9	748	6	746
AEW47953.1	0.0	23	748	24	750
AEW47958.1	0.0	23	748	24	750

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	6.65e-186	27	748	5	751	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	3.74e-185	27	748	5	751	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	1.13e-181	27	739	4	741	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	4.03e-171	31	748	2	732	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	1.51e-170	28	748	31	764	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	3.38e-184	39	748	41	764	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.07e-179	36	748	38	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
A7LXU3	4.27e-125	29	735	32	762	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
T2KMH0	1.12e-116	23	749	24	721	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	1.09e-114	23	750	26	756	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001650	0.997596	0.000197	0.000182	0.000165	0.000176

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002455_05258.