CAZyme Information: MGYG000002455_05259

Basic Information

• Species: Bacteroides cellulosilyticus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides cellulosilyticus
• CAZyme ID: MGYG000002455_05259
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
865	MGYG000002455_40|CGC1	100339.61	6.29

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002455	6974062	Isolate	United States	North America

• Gene Location: Start: 9692; End: 12289 Strand: +

Full Sequence      

MKKPNLNMKRASLLTSSLLCSALLIAVPLRKELNEGWQFKQARLSNWYPATVPGVVHTDL
INNKIIEDPFFRLNERGMQWIDKEDWIYQTSFQLTPEIMERQNIDLVFKGLDTYADVYLN
EKKILETNNMFREWKTNIKAELKPGENILKIYFHSPIKVDIPKWDALPYHYEASNDQSEN
GGLFDKKVSVFARKAGYHYGWDWGPRLVTSGIWRPVYIEAWDDARLSDVFIRQQEVSKSR
ASIVGEIEVQSDKEIDEATLTVTDAASGRVMAGKTVSLHKGNNKISLPFIIRNPRLWWSN
GLGEQHLYDFRTALTINNETSDIQSTKVGIRSLKIINRPDKDGKTFYVELNGVPVFAKGA
NYIPQDNFLPRVTPEQYEKTILDAANVNMNMLRIWGGGIYENDLFYELCDRYGILVWQDF
MFACSLYPAEGELLENIRQEAIDNVKRLRNHACIALWCGNNECNDAWFNWGWQKRYKAQN
PEYEKKIWKQFTDQYYVTLPEVVKEYAPESFYWPSSPFAREDGGSDDHNGDRHYWDVWHG
KKPIETYNKERSRFFSEYGFQSFPEFESVKRYAPCEEDWDIYSEVMMSHQRGGMHANQLI
ETYLLNEYRKPKNFEAFLYMNHVLQGDAIKTAIEAHRRDMPYCMGTLFWQHNDCWPVASW
ASRDYYGRWKAQHYFARKVYRDILVSPITDEGEVLNIQVVSDRLKSCNGTLQVEVMKLTG
EKVNSYKRNIKIDANSSQTVFSVPLGEALKNTPKEDVFVHAVLLTDKGKNSYANNYFLVK
QKEVNYPKAAITSSIEPIEGGFELTLNSDNFARAVFIIIGDVDSSFSDNYFDILPGGSVK
VNVYTDLPQPAFKKQLKVISLSDEY

Enzyme Prediction     

EC	3.2.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	30	811	1.6e-109	0.761968085106383

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.18e-113	30	853	12	798	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17786	Mannosidase_ig	8.39e-20	693	783	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam17753	Ig_mannosidase	1.72e-19	788	863	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10340	ebgA	3.20e-16	33	464	44	455	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	1.50e-14	30	462	12	417	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT88714.1	0.0	1	865	1	865
ALJ60279.1	0.0	1	865	1	865
QDO68488.1	0.0	1	865	1	865
QUT74423.1	0.0	1	865	1	864
QGT72566.1	0.0	26	865	30	867

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	6.22e-238	33	841	11	814	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	6.64e-238	33	841	13	816	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	6.86e-238	33	841	13	816	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	1.82e-237	33	841	11	814	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	7.97e-236	33	841	11	814	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B7W2	8.36e-133	33	749	9	737	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q4WAH4	3.63e-131	33	737	9	725	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
A2QYN2	4.96e-131	33	843	9	828	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
Q0CCA0	1.33e-130	30	685	6	656	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
B0YBU9	1.40e-130	33	737	9	725	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.709518	0.248911	0.038051	0.000642	0.000487	0.002391

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002455_05259.