CAZyme Information: MGYG000002459_01405

Basic Information

• Species: Bifidobacterium animalis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium animalis
• CAZyme ID: MGYG000002459_01405
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
154	MGYG000002459_1|CGC22	18151.49	10.2262

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002459	1958651	Isolate	China	Asia

• Gene Location: Start: 1646248; End: 1646712 Strand: +

Full Sequence      

MVHKRKPRLCFVSSSGGHWEQLQKLLPLAEKYEGFFVTEKTQFETPRAKYFMKQTDLKDK
FMVPKMIVNSARALVIWIKERPDFIITTGTMVAYPFYLLAVLFHKKFIFIETFGRANMPT
EAGKKMEKHSDLFIVQWESQKKFYTKAIYGGCLY

Enzyme Prediction     

No EC number prediction in MGYG000002459_01405.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08660	Alg14	1.43e-12	9	153	1	171	Oligosaccharide biosynthesis protein Alg14 like. Alg14 is involved dolichol-linked oligosaccharide biosynthesis and anchors the catalytic subunit Alg13 to the ER membrane.
COG0707	MurG	4.03e-04	6	112	1	122	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYD77862.1	7.80e-112	1	154	1	154
ASL78193.1	7.80e-112	1	154	1	154
AXM92922.1	7.80e-112	1	154	1	154
QBA09119.1	7.80e-112	1	154	1	154
QEG48856.1	7.80e-112	1	154	1	154

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
84	103