CAZyme Information: MGYG000002460_00320

Basic Information

• Species: Cronobacter sakazakii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Cronobacter; Cronobacter sakazakii
• CAZyme ID: MGYG000002460_00320
• CAZy Family: GT107
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
678	MGYG000002460_1|CGC5	74914.97	10.2371

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002460	4628081	Isolate	Mexico	North America

• Gene Location: Start: 336253; End: 338289 Strand: -

Full Sequence      

MKNSVTGIFSKGIWRIAGLHHLLPMPCRKLAPRRAIPDDVTAIAVWGRRPSAAAAVARAS
KAGLAVIRLEDGFIRSCGPAAHGYPPLSLVIDYDGIYYDASQPSTLENLIQDTAGNAALR
EAAQEAMRLIVEGDLAKYNHAPPFDGSPDARAVLVVDQTAGDMSVTFGNASAASFRLMLE
SALAENPDAEIWVKTHPDVVHGGKRGYLRDIRANTRLRLITEDASPQSLLRCVSRVYTVT
SHFGFEALMAGKPVVCFGQPWYAGWGLTDDRHPAAATLAARRGDASLLTLFSAAYLRYAR
YLNPQTNQPGTLFDVLTWLALQRRHHLALRGTLWVPGLTLWKRSVVKPFLSTPRNQLRFT
RRAPQADACVVWGTAGEARWQSTAQARGMPVWRMEDAFLRSVGLGSDLFAPLSLVLDKRG
LYYDATRASDLEIALNRVHLTPAEEARAAALRRQIIESRVSKYNAGGAWRLPASAWGRRI
LLVPGQVSDDASLVGGTQGIRTIAALLRMVRARNPQAYIVFKPHPDVACGNRQGEPSTRD
ALRWADCLATQADIVDVLDQVDEVHTLTSLAGFEALLRGKTVFCYGMPFYAGWGLTHDEY
PCPRRTRRLTLNALIHTTLIDYPFYLHPTRKTPIAAEEAVALLSASPRRNVTQHRRRKTL
TRLANKARNLFHALFYSR

Enzyme Prediction     

No EC number prediction in MGYG000002460_00320.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT107	281	674	4.2e-144	0.7481203007518797
GT107	37	309	4.2e-101	0.5075187969924813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3563	KpsC	0.0	8	674	6	670	Capsule polysaccharide export protein KpsC/LpsZ [Cell wall/membrane/envelope biogenesis].
cd16440	beta_Kdo_transferase_KpsC_1	1.49e-137	43	304	1	262	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat1. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16439	beta_Kdo_transferase_KpsC_2	1.17e-135	367	625	1	259	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC, repeat 2. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	5.61e-104	43	301	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.
cd16437	beta_Kdo_transferase_KpsC	4.49e-100	369	625	1	256	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsC. KpsC is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides, that are important virulence factors for many pathogenic bacteria. KpsC contains a domain duplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWR88292.1	0.0	1	678	1	678
QWR83610.1	0.0	1	678	1	678
ABU78573.1	0.0	1	678	1	678
QLJ50697.1	0.0	1	678	1	678
QGG05738.1	0.0	1	678	1	678

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MGC_A	1.27e-149	7	353	4	352	Escherichiacoli KpsC, N-terminal domain [Escherichia coli APEC O1]
6MGB_A	3.13e-73	6	319	11	321	Thermosulfurimonasdismutans KpsC, beta Kdo 2,4 transferase [Thermosulfurimonas dismutans]
6MGD_A	7.25e-65	339	640	10	315	Thermosulfurimonasdismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans],6MGD_B Thermosulfurimonas dismutans KpsC, beta Kdo 2,7 transferase [Thermosulfurimonas dismutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42217	9.32e-279	5	649	1	647	Capsule polysaccharide export protein KpsC OS=Escherichia coli OX=562 GN=kpsC PE=4 SV=1
Q05013	1.93e-190	10	643	28	671	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lipA PE=4 SV=2
P57037	2.19e-189	10	643	28	671	Capsule polysaccharide modification protein LipA OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=lipA PE=4 SV=1
P31858	7.22e-56	337	644	80	400	Lipopolysaccharide-processing protein LpsZ OS=Rhizobium meliloti OX=382 GN=lpsZ PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002460_00320.