CAZyme Information: MGYG000002460_02141

Basic Information

• Species: Cronobacter sakazakii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Cronobacter; Cronobacter sakazakii
• CAZyme ID: MGYG000002460_02141
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000002460_1|CGC36	43631.02	5.8115

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002460	4628081	Isolate	Mexico	North America

• Gene Location: Start: 2275193; End: 2276332 Strand: -

Full Sequence      

MIVWPVKHSPLLRQPERFIARDELKAMIHKITDNLINIKDETGQFLLRLDDGRVIDTKGW
AGWEWTHGVGLYGIYQYYRQTGDERMRAVIDDWFAARFAEGATTKNVNTMAPFLTLAYRY
EETRDPALLPWLETWAEWAMYEMPRTDQGGMQHITLAEENHQQMWDDTLMMTVLPLAKIG
KLLGRQAYVDEAIYQFLLHMQNLMDRKTGLWFHGWNYEGCHNFANARWARGNSWVTIVIP
DFLELMDWPEQHPVRRYLTQVLARQAAALAECQDESGLWHTLLDDPSSYLEASATAGFAC
GLLKAVRKRYIGKEYGLVAEKAIKGVVANVSPQGELLQVSFGTGMGSDLDFYRQIPLTSM
PYGQAMAILCLTEYLRTYL

Enzyme Prediction     

No EC number prediction in MGYG000002460_02141.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	60	376	1.3e-115	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	3.02e-134	30	379	3	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.15e-125	37	378	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXX02495.1	2.85e-292	1	379	1	379
QLJ48709.1	2.85e-292	1	379	1	379
ABU76618.1	2.85e-292	1	379	1	379
QWR85282.1	2.85e-292	1	379	1	379
QWR89962.1	2.85e-292	1	379	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	4.36e-234	3	378	5	380	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	3.04e-232	3	378	6	381	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	2.57e-151	23	379	7	373	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	5.22e-19	144	327	110	299	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3K11_A	2.33e-18	184	357	221	392	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	5.72e-53	63	377	29	338	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P9WF04	1.11e-08	165	375	201	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000082	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002460_02141.