CAZyme Information: MGYG000002460_03682

Basic Information

• Species: Cronobacter sakazakii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Cronobacter; Cronobacter sakazakii
• CAZyme ID: MGYG000002460_03682
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000002460_1|CGC54	41712.47	5.9477

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002460	4628081	Isolate	Mexico	North America

• Gene Location: Start: 3891451; End: 3892566 Strand: -

Full Sequence      

MKNLCRWLAAGLLLATVSAHAACGWADWDRFKGGYISEEGRVIDPSDPRKITTSEGQSYA
LFFALAANDREAFDNILQWTENNLAQGSLKNTLPAWLWGMKGPDEWTVLDTNSASDADLW
IAWSLLEAGRLWKEPRYSDTGKALLDRIAKEEVVNVPALGDMLLPGKVSFAEPTLWRFNP
SYMPPQLARYFTRYGKPWTTIRDTNLRLLLETAPQGFSPDWVSYEAKKGWVMKPAAPQKP
LIGSYDAIRVYLWVGMMNPADEQQAPLLKKLSPMETATIKAGVPPEKVRVIDGKTQGNGP
VGFSAALLPFLQNRDIQALQRQRVADNYPQQDAYFSYVLTLFGQGWDEHRFRFTVDGELQ
PAWGESCTSSR

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	25	346	7.6e-97	0.99375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11097	PRK11097	0.0	1	371	1	376	cellulase.
COG3405	BcsZ	6.03e-145	7	355	8	352	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	9.84e-108	22	349	1	321	Glycosyl hydrolases family 8.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXW98702.2	1.57e-285	1	371	1	371
QGG04997.1	1.57e-285	1	371	1	371
AZP31809.1	1.57e-285	1	371	1	371
AGE88461.1	1.57e-285	1	371	1	371
QWR86650.1	1.57e-285	1	371	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7F81_A	7.09e-189	19	371	2	351	ChainA, Glucanase [Enterobacter sp. CJF-002],7F81_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F81_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F81_D Chain D, Glucanase [Enterobacter sp. CJF-002]
3QXQ_A	3.33e-188	22	370	1	346	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]
7F82_A	1.17e-187	19	371	2	351	ChainA, Glucanase [Enterobacter sp. CJF-002],7F82_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F82_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F82_D Chain D, Glucanase [Enterobacter sp. CJF-002]
3QXF_A	7.03e-183	22	370	1	346	Structureof the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_B Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_C Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_D Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12]
4Q2B_A	6.15e-112	25	368	4	348	Thecrystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_B The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_C The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_D The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_E The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_F The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8ZLB7	7.85e-197	1	371	2	369	Endoglucanase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsZ PE=3 SV=1
Q8Z289	9.12e-196	1	371	2	369	Endoglucanase OS=Salmonella typhi OX=90370 GN=bcsZ PE=3 SV=1
Q8X5L9	9.72e-193	1	370	1	367	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
P37651	3.23e-191	12	370	12	367	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1
P58935	2.50e-98	8	363	15	375	Endoglucanase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003090	0.947824	0.048017	0.000350	0.000327	0.000357

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002460_03682.