CAZyme Information: MGYG000002461_01605

Basic Information

• Species: Yersinia kristensenii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yersinia; Yersinia kristensenii
• CAZyme ID: MGYG000002461_01605
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
639	MGYG000002461_3|CGC2	72204.97	9.1823

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002461	4771112	Isolate	Finland	Europe

• Gene Location: Start: 60886; End: 62805 Strand: +

Full Sequence      

MDKWRYLAIGVCLVTTSGVAFADSIDAQRQRYQQVKLAWDSNQLDTVAQLMPTLRDYPLY
PYLEYRQLTQDLSQVSAAQVTDFLTRNPTLPPASSLSSRFVNELARREDWRGLLAFSPQA
PKPAAARCNYYYAKWATGEQQVAWDGASEIWLNGQALPGSCDKLFNVWQQAGHQTPLATL
ARMKLALKEGNASLVSYLLKQLPADYQTMGTALAKLQSDPASVESFARTVGPTDFTRSAT
IIAFTRLARQDVENARAMIPTLARLQKMSDSEKLELEEAVAWRLMGNDANYEQAKWRDQV
TLRSHSTPLLERRIRMSLGTGDRQGLAAWIARLPAEAQNKDEWRYWRATLLLEQGKKAEG
EAILRSLMQERGFYPMVAAQKLGVPYPINVEVATKPDASLAQRPEIARVRELMYWNMDNL
ARNEWSYLVASRSKPEQEALARYAFDQKWADLSVQATIVAKLWDHLEERFPLAWPKEFRQ
ATEGKGITPSYAMAIARQESAWNPKAQSPVGAAGLMQVMPRTAEHTVKLNNIPGYVNSSQ
LLDPVTNIEIGTSYLEEVYQQFGRNRILSSAAYNAGPSRVNTWLGNSSGQVDAVAFIESI
PFSETRGYVKNVLAYDAFYRHFMNRPAKVLSDAEWQRRY

Enzyme Prediction     

No EC number prediction in MGYG000002461_01605.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	487	616	5.4e-30	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11619	PRK11619	0.0	1	639	6	644	lytic murein transglycosylase; Provisional
cd13401	Slt70-like	5.48e-64	469	621	1	151	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
COG0741	MltE	1.52e-46	341	628	1	292	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16896	LT_Slt70-like	1.55e-40	471	615	1	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	8.24e-37	478	587	1	106	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKJ15106.1	0.0	1	639	1	639
AJI88112.1	0.0	1	639	1	639
AIN16605.1	0.0	1	639	1	639
AJJ37475.1	0.0	1	639	1	639
AYD42867.1	0.0	1	639	1	639

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	1.73e-298	23	639	1	618	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	5.73e-297	23	639	1	618	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
5OHU_A	5.22e-93	3	639	2	638	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FBT_A	4.91e-92	28	639	1	609	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
6FCQ_A	1.46e-91	28	639	1	609	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC4	3.36e-307	4	639	9	645	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	3.36e-307	4	639	9	645	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	5.72e-301	4	639	9	645	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P44888	3.51e-77	219	639	175	593	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
P39433	2.55e-16	598	639	1	42	Soluble lytic murein transglycosylase (Fragment) OS=Enterobacter cloacae OX=550 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000378	0.998826	0.000221	0.000183	0.000191	0.000171

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002461_01605.