CAZyme Information: MGYG000002461_02161

Basic Information

• Species: Yersinia kristensenii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yersinia; Yersinia kristensenii
• CAZyme ID: MGYG000002461_02161
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
623	MGYG000002461_4|CGC4	69193.34	7.1223

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002461	4771112	Isolate	Finland	Europe

• Gene Location: Start: 252972; End: 254843 Strand: -

Full Sequence      

MKKVISAILLFSSCTYADVIPDAQLKEMWLSPKISAEKITSKMSFEEKLGQILMVDIRSW
SHSDNSDKTAFIEINDSVSKMIRDYHLGSIILFRENLIDTPQTVELINNLQKARSNLPLF
ISTDQEGGYVTRLRVGTEMPGNMALGATGSSKFAQQAGSIHGYELSSLGFNFNFGPVVDV
NNNQNNPVIGVRSYSNDPVLVGELARSYISGIHKYNVLTSLKHFPGHGNVTSDTHFSLPT
VNIDKAAWQQVELKPFVEVMPVTDAIMTAHVVVPALDNSMLTNIKGEEVGTPATLSKPIL
TDILRNQLKFDGLILTDAMDMGAITSNFDSHWSIKQAIMAGNDIILMPIEIKNSASTEQL
NALYNYLKTEAAKDPALKQRIEDAAQRVIYTKLNKRISPEPHDIAIAEKVVASKNHKDIE
NFISEQAITLIKNDNVLPYQVKPQNKIMVFSDEKPRNELIAKHLDDIANEFKVNFSVNNE
VIKLDKNDVNAEDIAKKIKDQKFIILATYNLKLNPVNAQRIIDEANKSNIPLVVVSSRNP
YDIAYLSGVKANIAIYGITGFDVTNNVRNSLETNIRSGLRTLFQGPKGKLDVLAKPQGKL
PVDIRTPDNSQILYPRGYGLTML

Enzyme Prediction     

No EC number prediction in MGYG000002461_02161.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	111	347	1.1e-61	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	3.44e-85	43	438	1	349	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	9.70e-78	44	389	1	314	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	9.79e-37	88	347	27	279	beta-hexosaminidase; Provisional
PRK15098	PRK15098	2.54e-06	42	449	44	415	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKJ14016.1	0.0	1	623	1	623
AIN19680.1	0.0	1	623	1	623
AYD45333.1	0.0	1	623	5	627
AJJ34236.1	0.0	1	623	1	623
AJI86276.1	0.0	1	623	1	623

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BMX_A	1.28e-122	4	622	8	636	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	4.76e-122	34	622	7	610	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.18e-121	34	622	37	640	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	2.52e-74	43	556	11	503	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
4ZM6_A	1.23e-59	44	559	8	502	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	7.00e-122	4	622	8	636	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	7.62e-76	43	454	16	440	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q7WUL3	1.29e-33	41	450	24	409	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
C4LEY6	1.67e-31	73	346	12	275	Beta-hexosaminidase OS=Tolumonas auensis (strain DSM 9187 / TA4) OX=595494 GN=nagZ PE=3 SV=1
B7UYS5	4.07e-31	80	368	20	292	Beta-hexosaminidase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000759	0.530535	0.468010	0.000258	0.000226	0.000204

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002461_02161.