CAZyme Information: MGYG000002461_02602

Basic Information

• Species: Yersinia kristensenii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yersinia; Yersinia kristensenii
• CAZyme ID: MGYG000002461_02602
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394		43295.82	6.9255

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002461	4771112	Isolate	Finland	Europe

• Gene Location: Start: 239095; End: 240279 Strand: +

Full Sequence      

MQNSPLSVDRPSNGVCPLTIGLVAGETSGDILGAGLIRALKAQVPDARFVGVAGPLMQAE
GCEAWFEMEELAVMGVVEVLERLPRLLKIRKELTQRFSELSPDVFVGIDAPDFNITLEGR
LKQRGIRTVHYVSPSVWAWRQKRVFKIGKATDMVLAFLPFEKAFYDRFNVPCRFIGHTMA
DTMPLVPDKLAAKVELGIAPQTPCLALLPGSRHSEVEMLSGDFLRTAAILKQQLPTLEVL
VPLVNSKRREQFERIKAEIAPDLPVHLLDGNARLAMIAADATLLASGTAALECMLAKCPM
VVGYRMKPFTFWLAERLVKTPYVSLPNLLAGEELVTELLQQECQPQKLADALLPLLQGGK
AVEALKERFLTLHQSIRCGADEQAAQAVLELAGR

Enzyme Prediction     

No EC number prediction in MGYG000002461_02602.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	20	377	4.7e-138	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00215	lpxB	0.0	19	391	7	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG0763	LpxB	0.0	17	394	1	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	0.0	17	394	1	377	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	1.07e-177	20	388	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	5.51e-53	22	380	231	593	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKJ17634.1	1.30e-282	1	394	1	394
AJJ34519.1	1.28e-273	1	394	1	394
AIN19635.1	1.28e-273	1	394	1	394
AYD44983.1	1.28e-273	1	394	1	394
AJI86708.1	1.28e-273	1	394	1	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	3.77e-209	17	392	6	381	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	3.09e-208	17	392	6	381	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q667K2	1.16e-254	1	394	1	394	Lipid-A-disaccharide synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=lpxB PE=3 SV=1
Q8ZH55	1.16e-254	1	394	1	394	Lipid-A-disaccharide synthase OS=Yersinia pestis OX=632 GN=lpxB PE=3 SV=1
Q7N8N4	1.85e-229	17	394	12	389	Lipid-A-disaccharide synthase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=lpxB PE=3 SV=1
A8GID3	2.36e-228	17	392	5	380	Lipid-A-disaccharide synthase OS=Serratia proteamaculans (strain 568) OX=399741 GN=lpxB PE=3 SV=1
C6DAJ6	2.87e-220	17	391	5	379	Lipid-A-disaccharide synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002461_02602.