CAZyme Information: MGYG000002462_00977

Basic Information

• Species: Yersinia kristensenii_B
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yersinia; Yersinia kristensenii_B
• CAZyme ID: MGYG000002462_00977
• CAZy Family: GH103
• CAZyme Description: Membrane-bound lytic murein transglycosylase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	MGYG000002462_2|CGC4	39400.5	8.5715

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002462	4324686	Isolate	Finland	Europe

• Gene Location: Start: 203141; End: 204217 Strand: -

Full Sequence      

MRHLAVILSSLILLSACSSKPTPPVAATPSDSLTRSGFLLEPQHMGHVPNGDFAYNADTA
RFVDKMVREHGFERQQLHDVLAQTKKLDFVIRLMDKQAPTSGRPSGPNGAWNRYRSQFIT
PGNVQNGVNFWNQYEDALQRAYEVYGVPPEIIVGIIGVETRWGRVMGKTRIIDALATLSF
AYPRRAEYFSGELETFLLMARAEGNDPLSLRGSYAGAMGYGQFMPSSFKDYAVDFNGNGH
INLWDPVDAIGSVANYFKAHGWTKGAVVAVPANGQAPNLDNGFKTQYPLSALSAAGLSPS
GSLGDYQEASLLRLDVGIGYQYWYGLPNFYTITRYNHSSHYAMAVWQLGEAVGRARKG

Enzyme Prediction     

No EC number prediction in MGYG000002462_00977.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH103	63	351	3.9e-93	0.9661016949152542

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10760	PRK10760	0.0	1	358	3	359	murein hydrolase B; Provisional
TIGR02282	MltB	6.96e-148	60	352	1	290	lytic murein transglycosylase B. This family consists of lytic murein transglycosylases (murein hydrolases) in the family of MltB, which is a membrane-bound lipoprotein in Escherichia coli. The N-terminal lipoprotein modification motif is conserved in about half the members of this family. The term Slt35 describes a naturally occurring soluble fragment of MltB. Members of this family never contain the putative peptidoglycan binding domain described by pfam01471, which is associated with several classes of bacterial cell wall lytic enzymes. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG2951	MltB	1.81e-119	1	358	3	341	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
pfam13406	SLT_2	8.75e-115	63	350	9	292	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
cd13399	Slt35-like	1.55e-29	145	351	1	108	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJI88329.1	2.35e-269	1	358	1	358
AJJ35760.1	2.35e-269	1	358	1	358
AIN19155.1	2.35e-269	1	358	1	358
AYD43350.1	2.95e-269	1	358	7	364
QKJ15677.1	4.69e-260	1	358	1	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1D0K_A	4.50e-184	39	356	1	320	ChainA, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0L_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0M_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1QDR_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QDT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUS_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli]
1LTM_A	2.41e-183	41	356	1	318	AcceleratedX-ray Structure Elucidation Of A 36 Kda Muramidase/transglycosylase Using Warp [Escherichia coli]
5O8X_A	4.61e-87	52	356	1	303	TheX-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa],5O8X_B The X-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
4ANR_A	1.58e-86	48	356	18	320	Crystalstructure of soluble lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5ANZ_A	6.89e-26	95	351	86	342	CrystalStructure of SltB3 from Pseudomonas aeruginosa. [Pseudomonas aeruginosa],5AO7_A Crystal Structure of SltB3 from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41052	3.04e-191	2	356	4	359	Membrane-bound lytic murein transglycosylase B OS=Escherichia coli (strain K12) OX=83333 GN=mltB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000054	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002462_00977.