CAZyme Information: MGYG000002463_02976

Basic Information

• Species: Pseudomonas aeruginosa
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas; Pseudomonas aeruginosa
• CAZyme ID: MGYG000002463_02976
• CAZy Family: GT2
• CAZyme Description: Acetyl-coenzyme A synthetase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
645		71610.05	6.2312

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002463	6750396	Isolate	Brazil	South America

• Gene Location: Start: 59660; End: 61597 Strand: -

Full Sequence      

MFEISVHPVPDAVRQRAYLNDDDYQRLYRQSVENPDEFWGEQAKAFLDWFKPWHSVHHGD
LRKGQATWFKGGQLNVAYNCIDRHLERRGEQIAIVWEGDNPSESAHITYRKLHHNVCRLA
NVLKSRGVEKGDRVCIYMPMIPEAAYAMLACARIGAVHSVVFGGFSPDSLRDRILDADCR
TVITADEGVRGGKYIPLKQNVEKALKDCPDVSTVVVVERTQGDIPWVEGRDIWYHEALHA
ASADCPAEAMDAEDPLFILYTSGSTGKPKGVLHTTGGYLLGAAMTHKYVFDYHDGDVYWC
TADVGWVTGHSYIVYGPLANGATTLMFEGVPNYPDASRFWQVIDKHQVNIFYTAPTAIRA
LMREGDAPVRQTSRSSLRLLGSVGEPINPEAWEWYYQVVGEKRCPIVDTWWQTETGSILI
TPLPGATALKPGSATRPFFGVQPVLLDEKGKEIDGAGSGVLAIKASWPSQIRSVYGDHQR
MIDTYFKPYPGYYFSGDGARRDEDGYYWITGRVDDVINVSGHRIGTAEVESALVLHDAVA
EAAVVGCPHDVKGQAIYAFVTLMAGSQPSEALQQELLALVGKEIGSFAKPDHLQWAPSLP
KTRSGKIMRRILRKIACNELDSLGDTSTLADPGVVQGLIDNRLNR

Enzyme Prediction     

No EC number prediction in MGYG000002463_02976.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0365	Acs	0.0	67	621	1	525	Acyl-coenzyme A synthetase/AMP-(fatty) acid ligase [Lipid transport and metabolism].
PRK04319	PRK04319	0.0	20	631	14	570	acetyl-CoA synthetase; Provisional
PRK00174	PRK00174	0.0	6	645	1	636	acetyl-CoA synthetase; Provisional
TIGR02188	Ac_CoA_lig_AcsA	0.0	20	641	3	626	acetate--CoA ligase. This model describes acetate-CoA ligase (EC 6.2.1.1), also called acetyl-CoA synthetase and acetyl-activating enzyme. It catalyzes the reaction ATP + acetate + CoA = AMP + diphosphate + acetyl-CoA and belongs to the family of AMP-binding enzymes described by pfam00501.
PLN02654	PLN02654	0.0	6	639	14	661	acetate-CoA ligase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE6201330.1	1.21e-260	6	639	564	1210
CAE6201338.1	1.68e-260	6	639	575	1221
AFY93865.1	6.95e-23	73	612	329	842
AFZ04852.1	2.98e-18	78	612	587	1074
CAE6256584.1	2.85e-16	250	615	1706	2058

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P20_A	4.78e-313	1	642	1	645	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P20_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]
2P2Q_A	9.63e-313	1	642	1	645	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P2Q_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]
2P2F_A	9.63e-313	1	642	1	645	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P2F_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]
5JRH_A	1.29e-312	1	642	1	645	Crystalstructure of Salmonella enterica acetyl-CoA synthetase (Acs) in complex with cAMP and Coenzyme A [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5JRH_B Crystal structure of Salmonella enterica acetyl-CoA synthetase (Acs) in complex with cAMP and Coenzyme A [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
2P2M_A	2.75e-312	1	642	1	645	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P2M_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q21LV0	0.0	6	645	6	645	Acetyl-coenzyme A synthetase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) OX=203122 GN=acsA PE=3 SV=1
Q6MNF1	0.0	5	645	4	645	Acetyl-coenzyme A synthetase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100) OX=264462 GN=acsA PE=3 SV=1
Q2LW77	0.0	8	643	7	642	Acetyl-coenzyme A synthetase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=acsA PE=3 SV=1
Q2K2T1	0.0	5	645	4	648	Acetyl-coenzyme A synthetase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) OX=347834 GN=acsA PE=3 SV=1
Q88DW6	0.0	1	645	1	644	Acetyl-coenzyme A synthetase 2 OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=acsA2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002463_02976.