CAZyme Information: MGYG000002463_04406

Basic Information

• Species: Pseudomonas aeruginosa
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas; Pseudomonas aeruginosa
• CAZyme ID: MGYG000002463_04406
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
209		22994.88	10.3536

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002463	6750396	Isolate	Brazil	South America

• Gene Location: Start: 31949; End: 32578 Strand: -

Full Sequence      

MKLTEQQLLRIFPNARLVAGVFVAALQRAMDEREIDTPARRAAFLAQVGHESSQLTRLVE
NLNYSAQGLAATWPSRYLGPDGQPNALALRLARNPQAIADNTYATRNGNGDEASGDGWRF
RGRGLLQITGRANYRLVGEALGEPLEAEPWRLEQPVSAARSAAWWWAGHGLNELADRGEF
AAITRRINGGLNGQAERLALWQRARAVLS

Enzyme Prediction     

No EC number prediction in MGYG000002463_04406.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	33	194	2.5e-33	0.6406926406926406

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3179	COG3179	2.97e-87	1	209	2	205	Predicted chitinase [General function prediction only].
cd00325	chitinase_GH19	5.98e-05	3	191	1	190	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVN44077.1	1.16e-149	1	209	1	209
AYK21182.1	1.16e-149	1	209	1	209
VUY42823.1	6.69e-149	1	209	1	209
AHW69112.1	6.69e-149	1	209	1	209
VEE49978.1	6.69e-149	1	209	1	209

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OK7_A	3.00e-35	14	209	28	223	ChainA, Endolysin [Salmonella phage SPN1S],4OK7_B Chain B, Endolysin [Salmonella phage SPN1S],4OK7_C Chain C, Endolysin [Salmonella phage SPN1S]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44187	2.25e-38	1	202	3	192	Glycosyl hydrolase family 19 domain-containing protein HI_1415 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1415 PE=3 SV=1
O64203	9.32e-10	19	207	196	360	Endolysin A OS=Mycobacterium phage D29 OX=28369 GN=10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000023	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002463_04406.