CAZyme Information: MGYG000002464_03335

Basic Information

• Species: Acetivibrio_A ethanolgignens
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetivibrio_A; Acetivibrio_A ethanolgignens
• CAZyme ID: MGYG000002464_03335
• CAZy Family: GH13
• CAZyme Description: Glycogen operon protein GlgX

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
636	MGYG000002464_208|CGC1	73478.45	7.7727

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002464	3659621	Isolate	not provided	not provided

• Gene Location: Start: 21847; End: 23757 Strand: +

Full Sequence      

MGTVEKNRFSLKKGGLFPFGVVADRRGVQFTFAAYEGKKAGICLYHRSSGERQYIPAEKK
YQTGNLYSIYIRGLRAEEYDYTLQYDDIEILDPYAKKLSGHESWGSSLKKVGKEGVRGRL
DFAAGGMERDVPPEISYENLYLYQLHVRGFTKHTSSGVKGKGTFQGIMEKIPYLKELGVN
GLLVLPVYDFDEILENGLEDVTREHLERYGKQNLEEKTEEKKRRLNYWGYTRRAAWLVPK
ASYASDTAYPEKELKELIRRLHEENILFLMEMYFPEGTSPVLIQEVLRYWILEYHVDGFR
INDNVAPMQVLAADPIIGSVKLLANNWAEEAVYGKEAAPKKKVLAEANESFLRHMRRFLK
SDEGQIGAVLYHMRHNPEKKASVNYITQFNTFTLQDLVSYDVKHNEENGENGRDGTDFNY
SWNCGVEGKTRKKAVLNLRQRQVRNALLLLYLSQGTPMLLAGDEFGNSQEGNNNAYCQDN
EISWLNWNQLKKNQELFLFVKELIALRKEHPMLHKAEELTGRDYISCGCPDISYHGTKSW
YLDNSNYSRVVGIMLCGDYALLDKVNRDWDFYLAYNFHWEPHDYELPKPNSGGKWEILKD
TSEQAVLEKKQLTVPERTVVLLASEPTAKKKKRERK

Enzyme Prediction     

EC	3.2.1.68	3.2.1.-	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	282	468	2.2e-53	0.5868945868945868

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11326	AmyAc_Glg_debranch	4.68e-129	128	510	4	433	Alpha amylase catalytic domain found in glycogen debranching enzymes. Debranching enzymes facilitate the breakdown of glycogen through glucosyltransferase and glucosidase activity. These activities are performed by a single enzyme in mammals, yeast, and some bacteria, but by two distinct enzymes in Escherichia coli and other bacteria. Debranching enzymes perform two activities: 4-alpha-D-glucanotransferase (EC 2.4.1.25) and amylo-1,6-glucosidase (EC 3.2.1.33). 4-alpha-D-glucanotransferase catalyzes the endohydrolysis of 1,6-alpha-D-glucoside linkages at points of branching in chains of 1,4-linked alpha-D-glucose residues. Amylo-alpha-1,6-glucosidase catalyzes the endohydrolysis of 1,6-alpha-D-glucoside linkages at points of branching in chains of 1,4-linked alpha-D-glucose residues. In Escherichia coli, GlgX is the debranching enzyme and malQ is the 4-alpha-glucanotransferase. TreX, an archaeal glycogen-debranching enzyme has dual activities like mammals and yeast, but is structurally similar to GlgX. TreX exists in two oligomeric states, a dimer and tetramer. Isoamylase (EC 3.2.1.68) is one of the starch-debranching enzymes that catalyzes the hydrolysis of alpha-1,6-glucosidic linkages specific in alpha-glucans such as amylopectin or glycogen and their beta-limit dextrins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
COG1523	PulA	8.38e-115	1	629	1	696	Pullulanase/glycogen debranching enzyme [Carbohydrate transport and metabolism].
TIGR02100	glgX_debranch	1.71e-114	17	622	5	686	glycogen debranching enzyme GlgX. This family consists of the GlgX protein from the E. coli glycogen operon and probable equivalogs from other prokaryotic species. GlgX is not required for glycogen biosynthesis, but instead acts as a debranching enzyme for glycogen catabolism. This model distinguishes GlgX from pullanases and other related proteins that also operate on alpha-1,6-glycosidic linkages. In the wide band between the trusted and noise cutoffs are functionally similar enzymes, mostly from plants, that act similarly but usually are termed isoamylase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK03705	PRK03705	3.58e-80	11	513	4	564	glycogen debranching protein GlgX.
PRK14510	PRK14510	4.14e-69	17	538	14	597	bifunctional glycogen debranching protein GlgX/4-alpha-glucanotransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF41510.1	8.45e-205	3	629	6	639
BCN30257.1	2.34e-191	6	631	2	638
QHQ62853.1	1.27e-165	162	624	4	453
BCJ95769.1	2.18e-165	11	624	9	615
BCK00591.1	7.01e-163	20	619	67	655

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VNC_A	4.28e-70	11	621	12	712	Crystalstructure of Glycogen Debranching enzyme TreX from Sulfolobus solfataricus [Saccharolobus solfataricus],2VNC_B Crystal structure of Glycogen Debranching enzyme TreX from Sulfolobus solfataricus [Saccharolobus solfataricus],2VR5_A Crystal structure of Trex from Sulfolobus Solfataricus in complex with acarbose intermediate and glucose [Saccharolobus solfataricus],2VR5_B Crystal structure of Trex from Sulfolobus Solfataricus in complex with acarbose intermediate and glucose [Saccharolobus solfataricus],2VUY_A Crystal structure of Glycogen Debranching exzyme TreX from Sulfolobus solfatarius [Saccharolobus solfataricus],2VUY_B Crystal structure of Glycogen Debranching exzyme TreX from Sulfolobus solfatarius [Saccharolobus solfataricus],7EAV_A Chain A, Glycogen debranching enzyme [Saccharolobus solfataricus],7EAV_B Chain B, Glycogen debranching enzyme [Saccharolobus solfataricus]
4J7R_A	2.62e-63	66	605	132	784	CrystalStructure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) [Chlamydomonas reinhardtii],4J7R_B Crystal Structure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) [Chlamydomonas reinhardtii],4OKD_A Crystal Structure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) in complex with maltoheptaose [Chlamydomonas reinhardtii],4OKD_B Crystal Structure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) in complex with maltoheptaose [Chlamydomonas reinhardtii]
2WSK_A	1.50e-50	18	513	11	564	Crystalstructure of Glycogen Debranching Enzyme GlgX from Escherichia coli K-12 [Escherichia coli K-12]
6JEQ_A	5.51e-23	89	519	113	572	Crystalstructure of Pullulanase from Paenibacillus barengoltzii complex with beta-cyclodextrin [Paenibacillus barengoltzii],6JFJ_A Crystal structure of Pullulanase from Paenibacillus barengoltzii complex with maltohexaose and alpha-cyclodextrin [Paenibacillus barengoltzii],6JFX_A Crystal structure of Pullulanase from Paenibacillus barengoltzii complex with maltopentaose [Paenibacillus barengoltzii],6JHF_A Crystal structure of apo Pullulanase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],6JHG_A Crystal structure of apo Pullulanase from Paenibacillus barengoltzii in space group P212121 [Paenibacillus barengoltzii]
6JHH_A	1.28e-22	89	519	113	572	Crystalstructure of mutant D350A of Pullulanase from Paenibacillus barengoltzii complexed with maltotriose [Paenibacillus barengoltzii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9M0S5	1.09e-75	5	602	79	732	Isoamylase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ISA3 PE=1 SV=2
B9G434	2.02e-73	9	616	98	759	Isoamylase 3, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=ISA3 PE=2 SV=1
O22637	5.40e-69	18	621	87	761	Isoamylase SU1, chloroplastic OS=Zea mays OX=4577 GN=SU1 PE=1 SV=1
O04196	4.75e-68	4	621	62	753	Isoamylase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ISA1 PE=1 SV=1
D0TZF0	4.42e-67	18	605	103	759	Isoamylase 1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=ISA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002464_03335.