CAZyme Information: MGYG000002465_01436

Basic Information

• Species: Yersinia massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yersinia; Yersinia massiliensis
• CAZyme ID: MGYG000002465_01436
• CAZy Family: GH104
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
152	MGYG000002465_7|CGC1	16747.09	9.7471

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002465	4872451	Isolate	Finland	Europe

• Gene Location: Start: 11383; End: 11841 Strand: +

Full Sequence      

MQISKNLKAFLDMLAWSEGTSRTAGSDNGYNVIVGGKLFTGYQDHPRVVVELPRLGIKST
AAGRYQLLSRYWDAYKKQLGLKDFSPASQDAVAIQQIRERKALQDIEAGNIESAIRKCSN
IWASLPGAGYGQFEHKVEPLIQQYVKAGGTLA

Enzyme Prediction     

EC	4.2.2.N1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH104	3	147	3e-60	0.9793103448275862

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00736	lambda_lys-like	2.54e-83	5	149	1	141	Bacteriophage lambda lysozyme and similar proteins. Lysozyme from bacteriophage lambda hydrolyzes the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc), as do other lysozymes. However, unlike other lysozymes, bacteriophage lambda does not produce a reducing end upon cleavage of the peptidoglycan, but rather uses the 6-OH of the same MurNAc residue to produce a 1,6-anhydromuramic acid terminal residue and is therefore a lytic transglycosylase. An identical 1,6-anhydro bond is formed in bacterial peptidoglycans by the action of the lytic transglycosylases of E. coli, though they differ structurally.
COG4678	COG4678	3.99e-72	4	152	27	179	Muramidase (phage lambda lysozyme) [Cell wall/membrane/envelope biogenesis, Mobilome: prophages, transposons].
pfam00959	Phage_lysozyme	1.26e-20	30	136	1	105	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.
cd00442	Lyz-like	6.46e-05	54	96	17	59	lysozyme-like domains. This family contains several members, including soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, chitosanases, and pesticin. Typical members are involved in the hydrolysis of beta-1,4- linked polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALX94650.1	1.27e-82	1	152	1	152
QDL31298.1	2.36e-74	3	152	4	155
QFH71058.1	5.26e-74	3	149	4	151
QGH63416.1	1.87e-73	1	152	1	154
QDX21429.1	2.14e-73	5	151	12	158

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1D9U_A	1.14e-66	1	151	2	153	ChainA, Bacteriophage Lambda Lysozyme [Lambdavirus lambda],1D9U_B Chain B, Bacteriophage Lambda Lysozyme [Lambdavirus lambda],3D3D_A Chain A, Lysozyme [Lambdavirus lambda],3D3D_B Chain B, Lysozyme [Lambdavirus lambda]
1AM7_A	1.11e-60	1	151	2	153	ChainA, LYSOZYME [Lambdavirus lambda],1AM7_B Chain B, LYSOZYME [Lambdavirus lambda],1AM7_C Chain C, LYSOZYME [Lambdavirus lambda]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P03706	7.11e-66	1	151	2	153	Endolysin OS=Escherichia phage lambda OX=10710 GN=R PE=1 SV=1
P51771	7.62e-48	5	152	8	165	Endolysin OS=Escherichia phage P2 OX=10679 GN=K PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002465_01436.