CAZyme Information: MGYG000002465_02424

Basic Information

• Species: Yersinia massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yersinia; Yersinia massiliensis
• CAZyme ID: MGYG000002465_02424
• CAZy Family: PL22
• CAZyme Description: Oligogalacturonate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	MGYG000002465_14|CGC1	44749.04	5.0482

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002465	4872451	Isolate	Finland	Europe

• Gene Location: Start: 99721; End: 100896 Strand: +

Full Sequence      

MAKGDIYPLEYHEYIDEDTGSRVTRLTPTNVICHRNYFYQKCFLDEGRSLIFAAEFDGFR
NYYRLELSSGIATQLTEGAGDNTFGGFLSPDEQYLYYVKSERNLMRVTLKDLSEISVYQV
ADEWVGYGTWVANSDCTKLVGVEIHRDSWRPVSDWTVFQQFYEEQPLCRVIRVDLHNGHR
TTLLQENQWLGHPIYRPYDDNTVAFCHEGPLDRVETRMWLMNEDGSHIRRVKQPAPGESY
THEFWVPDGSAMMYVTYVKDSPVRYLCRVSPDTGLDEKIVAMPPCSHVMSNHNGQLAVGD
GSGKPIDIVDNDKYGDATDPYLYLFDLKNQKNHRIAKHSSSWAVLDGDRQVTHPHPSFTP
DEKSVLFSSDKDGLPALYLATIPASILDSIQ

Enzyme Prediction     

EC	4.2.2.6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL22	216	381	1.1e-62	0.6226415094339622
PL22	33	139	8.5e-24	0.9811320754716981

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14583	Pectate_lyase22	0.0	1	386	1	386	Oligogalacturonate lyase. This is a family of oligogalacturonate lyases, referred to more generally as pectate lyase family 22. These proteins fold into 7-bladed beta-propellers.
COG0823	TolB	6.37e-27	1	379	58	398	Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking, secretion, and vesicular transport].
PRK04792	tolB	2.27e-06	245	378	225	333	Tol-Pal system protein TolB.
PRK05137	tolB	1.23e-05	197	378	162	317	Tol-Pal system protein TolB.
PRK01029	tolB	3.35e-05	218	383	167	313	Tol-Pal system protein TolB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKJ11707.1	4.85e-306	1	391	1	391
AVX36903.1	4.85e-306	1	391	1	391
ATM87292.1	4.85e-306	1	391	1	391
QZN95508.1	1.95e-271	1	391	1	391
AJW28899.1	1.35e-265	1	391	1	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PE7_A	2.50e-189	1	386	1	386	Oligogalacturonatelyase in complex with manganese [Yersinia enterocolitica subsp. enterocolitica 8081]
3C5M_A	2.47e-172	2	385	2	385	Crystalstructure of oligogalacturonate lyase (VPA0088) from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR199 [Vibrio parahaemolyticus RIMD 2210633],3C5M_B Crystal structure of oligogalacturonate lyase (VPA0088) from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR199 [Vibrio parahaemolyticus RIMD 2210633],3C5M_C Crystal structure of oligogalacturonate lyase (VPA0088) from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR199 [Vibrio parahaemolyticus RIMD 2210633]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59418	1.52e-192	1	386	1	386	Oligogalacturonide lyase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=ogl PE=4 SV=2
P21258	3.37e-189	1	386	1	386	Oligogalacturonate lyase OS=Dickeya dadantii (strain 3937) OX=198628 GN=ogl PE=2 SV=2
A5VS52	6.57e-06	198	379	171	327	Tol-Pal system protein TolB OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) OX=444178 GN=tolB PE=3 SV=1
A9M7J5	6.57e-06	198	379	171	327	Tol-Pal system protein TolB OS=Brucella canis (strain ATCC 23365 / NCTC 10854) OX=483179 GN=tolB PE=3 SV=1
A9WWH3	6.57e-06	198	379	171	327	Tol-Pal system protein TolB OS=Brucella suis (strain ATCC 23445 / NCTC 10510) OX=470137 GN=tolB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002465_02424.