CAZyme Information: MGYG000002465_04139

Basic Information

• Species: Yersinia massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yersinia; Yersinia massiliensis
• CAZyme ID: MGYG000002465_04139
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
208		22891.95	10.0449

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002465	4872451	Isolate	Finland	Europe

• Gene Location: Start: 18082; End: 18708 Strand: -

Full Sequence      

MTPYQFRMAANISAELAARWIQPITLAMKEFGITTPVQQAMFIAQVGHESASFTLLVESF
NYSVNGLIATFGKRLSADQASALGRQSGEKSVPLNRQQAIANLVYSGRMGNKAAGDGWKY
RGRGLIQITGLDNYRACGTALKLDLISNPDQLQSDVNAARSAAWFWQSRNCGQYADDVQR
VTQLINGGNNGINDRKARFELAKRELQL

Enzyme Prediction     

EC	3.2.1.17

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	34	186	1.9e-34	0.4935064935064935

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3179	COG3179	3.64e-74	1	203	4	201	Predicted chitinase [General function prediction only].
pfam00182	Glyco_hydro_19	1.17e-09	117	195	104	207	Chitinase class I.
cd00325	chitinase_GH19	3.94e-08	119	191	102	178	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHM75157.1	4.51e-142	1	207	1	207
QAX77676.1	4.51e-142	1	208	1	208
AHM72992.1	6.40e-142	1	208	1	208
QHB31864.1	1.84e-141	1	208	1	208
QCW23401.1	3.55e-139	1	208	1	208

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OK7_A	1.00e-85	5	206	20	222	ChainA, Endolysin [Salmonella phage SPN1S],4OK7_B Chain B, Endolysin [Salmonella phage SPN1S],4OK7_C Chain C, Endolysin [Salmonella phage SPN1S]
7F88_A	4.85e-08	62	188	30	158	ChainA, Chitinase A [Gemmabryum coronatum],7F88_B Chain B, Chitinase A [Gemmabryum coronatum],7F88_C Chain C, Chitinase A [Gemmabryum coronatum]
3WH1_A	5.34e-08	117	188	91	167	CrystalStructure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
4IJ4_A	7.23e-08	117	188	90	166	CrystalStructure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]
4MST_A	1.34e-07	117	168	105	157	CrystalStructure of a putative catalytic domain of a chitinase-like protein (HbCLP1) from Hevea brasiliensis [Hevea brasiliensis],4MST_B Crystal Structure of a putative catalytic domain of a chitinase-like protein (HbCLP1) from Hevea brasiliensis [Hevea brasiliensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44187	4.71e-31	22	195	23	187	Glycosyl hydrolase family 19 domain-containing protein HI_1415 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1415 PE=3 SV=1
Q7XCK6	3.79e-08	120	168	128	177	Chitinase 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht8 PE=2 SV=1
O64203	1.13e-07	34	202	213	357	Endolysin A OS=Mycobacterium phage D29 OX=28369 GN=10 PE=1 SV=1
Q10S66	3.17e-07	120	168	121	170	Chitinase 11 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht11 PE=2 SV=1
Q8GUD7	9.40e-07	117	168	158	210	Probable inactive chitinase-like protein LaCIC (Fragment) OS=Hevea brasiliensis OX=3981 GN=LACIC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002465_04139.