CAZyme Information: MGYG000002467_03388

Basic Information

• Species: Yersinia frederiksenii_C
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yersinia; Yersinia frederiksenii_C
• CAZyme ID: MGYG000002467_03388
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
623	MGYG000002467_7|CGC2	69416.63	6.8768

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002467	4928795	Isolate	Finland	Europe

• Gene Location: Start: 232591; End: 234462 Strand: +

Full Sequence      

MKVIIPAILLFSSCAYADVIPDPQLKEMWLSPQTSAEKIISNMSFEEKLGQILMVDIRSW
SNDNNDDKKPFIEINDTVSKMIRDYHLGSIILFRENLIDTPQTVELINNLQRARSNFPLF
ISTDQEGGYVTRLRVGTEMPGNMALGATGSSKLAEQAGSIHGYELSSLGFNFNFGPVVDV
NNNQNNPVIGVRSYSDDPVLVGELARSYINGIHKSNVLSSLKHFPGHGNVSSDTHFALPT
VNIDKASWQQVELKPFFEVMPVTDAIMTAHIVVPALDNAMLTNIKGEKIGTPATLSKPIL
TGILRNQLKYNGLILTDAMDMGAITGNFDRNWSIKQAIMAGNDIVLMPMEIKNSASVEQL
NGLYHYLKAEAVKDPVLKQRIEDAAQRVIYTKLSKRISADPHDVATAERVVASKNHKDIE
NFISEQAITLIKNDNVLPYHLKPQNNIMVFSDEKPRNELITKHLYDIADQFHVTFDVKNE
VIKLDKDDIRPEEIAKQIKGQNLIILATYNLKLNPVNAQRIIDVANKENIPLVVISSRNP
YDIAYLSNVKANIAIYGITGFDVTNNVRNSLETNIRSGLRTLFQGPKGKLDVLAKPHGKL
PVDIRTPDNSQILYPRGYGLTLL

Enzyme Prediction     

No EC number prediction in MGYG000002467_03388.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	112	347	9.9e-61	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.88e-84	43	444	1	355	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	2.21e-76	44	389	1	314	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	6.61e-36	88	365	27	307	beta-hexosaminidase; Provisional
PRK15098	PRK15098	2.38e-07	7	449	10	415	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATM94370.1	0.0	1	623	1	623
AJJ09747.1	0.0	1	622	1	622
AHM72111.1	0.0	1	623	5	627
AJJ19713.1	0.0	1	623	1	623
QAX80520.1	0.0	1	623	5	627

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BMX_A	1.70e-119	36	622	35	636	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	4.53e-119	36	622	9	610	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.11e-118	36	622	39	640	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	6.08e-77	43	556	11	503	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
4ZM6_A	1.10e-53	44	559	8	502	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	9.32e-119	36	622	35	636	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	2.14e-74	43	454	16	440	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q7WUL3	4.67e-35	40	557	23	528	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
C4LEY6	3.97e-33	73	346	12	275	Beta-hexosaminidase OS=Tolumonas auensis (strain DSM 9187 / TA4) OX=595494 GN=nagZ PE=3 SV=1
Q5QUZ5	2.86e-31	80	347	19	276	Beta-hexosaminidase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) OX=283942 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000528	0.520438	0.478393	0.000233	0.000212	0.000192

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002467_03388.