CAZyme Information: MGYG000002470_00027

Basic Information

• Species: Bacteroides intestinalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides intestinalis
• CAZyme ID: MGYG000002470_00027
• CAZy Family: GH9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
836		94671.11	6.2121

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002470	5774847	Isolate	Ireland	Europe

• Gene Location: Start: 28199; End: 30709 Strand: -

Full Sequence      

MKSNHWLLTVALTFIVLQTKADAWIRINQLGYLPQSVKVAVFMSEEPTDIQEYALVDAFT
GQTVRTFNSIKSTGKMGLMKSTYRLNFSDFNQPGTYYLKAGKAVSPHFPINNHVYNGTAD
FLLNYMRQQRCGYNSFLKDSCHVHDGYILYHPTKTGQHIDVRGGWHDATDYLQYTTTSAN
AIYQMMFAYQENPESFGDFYDAAGLPGANGIPDIVDEIKWGLDWLNRMNPAPGELYNQIA
DDRDHAGMRLPNKDKVDYGYGPGNGRPVYFCSGEPQVRGQFMNATTGVASTAGKYASCFA
LGARLLKNFYPEFAAEIEAKADAAYQQGVKKPGACQTASVLSPYIYEEDNWVDDMELGAM
ELFKSTGDLTYLQQAVEYGRREPVTPWMGADSARHYQWYPFMNMGHYHLAKVNNDRLSKE
FIRNMHTGIVRTYEKAVESPFMHGIPYTWCSNNLTTAMLTQCRLYREATGDETYKEMEAA
MLDWLFGCNPWGTSMVVELPLYGDYPSQPHSSLLNAGVGNTTGGLVDGPVYRTIFESLRG
VNMTGIPGTPGQDYERFQPDLMVYHDAIHDYSTNEPTMDGTACLTYYLSAMQKEGMKQAN
IQGDKNIYVNGGIIRTDPSKKQITLVFTAADKADGADAIISTLKKYGIKGGFFFTGEFYE
LYPEVIKRLRTEGHLVGSHSYGHLLYMPWENRDSLLVTREQFEQDMLKSYAGMREAGIEY
KDAPVYIPPYEYYNKEIAAWAKNMGIQLINYTPGTMSNADYTTPDMGQKYRSSKFIYDKI
MEIEKKEGLNGHLMLIHFGTDDRRTDKFYNGYLDKMIKTLKRKGYTFVPVLEAIGM

Enzyme Prediction     

No EC number prediction in MGYG000002470_00027.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH9	115	588	3.6e-76	0.992822966507177
CE4	617	749	6.3e-17	0.9230769230769231

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00759	Glyco_hydro_9	1.72e-62	123	588	7	374	Glycosyl hydrolase family 9.
pfam02927	CelD_N	6.06e-27	23	105	1	83	Cellulase N-terminal ig-like domain.
cd10917	CE4_NodB_like_6s_7s	8.64e-26	639	821	19	171	Catalytic NodB homology domain of rhizobial NodB-like proteins. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes many rhizobial NodB chitooligosaccharide N-deacetylase (EC 3.5.1.-)-like proteins, mainly from bacteria and eukaryotes, such as chitin deacetylases (EC 3.5.1.41), bacterial peptidoglycan N-acetylglucosamine deacetylases (EC 3.5.1.-), and acetylxylan esterases (EC 3.1.1.72), which catalyze the N- or O-deacetylation of substrates such as acetylated chitin, peptidoglycan, and acetylated xylan. All members of this family contain a catalytic NodB homology domain with the same overall topology and a deformed (beta/alpha)8 barrel fold with 6- or 7 strands. Their catalytic activity is dependent on the presence of a divalent cation, preferably cobalt or zinc, and they employ a conserved His-His-Asp zinc-binding triad closely associated with the conserved catalytic base (aspartic acid) and acid (histidine) to carry out acid/base catalysis. Several family members show diversity both in metal ion specificities and in the residues that coordinate the metal.
cd02850	E_set_Cellulase_N	3.97e-25	24	110	1	86	N-terminal Early set domain associated with the catalytic domain of cellulase. E or "early" set domains are associated with the catalytic domain of cellulases at the N-terminal end. Cellulases are O-glycosyl hydrolases (GHs) that hydrolyze beta 1-4 glucosidic bonds in cellulose. They are usually categorized into either exoglucanases, which sequentially release terminal sugar units from the cellulose chain, or endoglucanases, which also attack the chain internally. The N-terminal domain of cellulase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
cd10950	CE4_BsYlxY_like	5.33e-21	616	834	1	188	Putative catalytic NodB homology domain of uncharacterized protein YlxY from Bacillus subtilis and its bacterial homologs. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. This family is represented by Bacillus subtilis putative polysaccharide deacetylase BsYlxY, encoded by the ylxY gene, which is a member of the carbohydrate esterase 4 (CE4) superfamily. Although its biological function still remains unknown, BsYlxY shows high sequence homology to the catalytic domain of Bacillus subtilis pdaB gene encoding a putative polysaccharide deacetylase (BsPdaB), which is essential for the maintenance of spores after the late stage of sporulation and is highly conserved in spore-forming bacteria. However, disruption of the ylxY gene in B. subtilis did not cause any sporulation defect. Moreover, the Asp residue in the classical His-His-Asp zinc-binding motif of CE4 esterases is mutated to a Val residue in this family. Other catalytically relevant residues of CE4 esterases are also not conserved, which suggest that members of this family may be inactive.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO71291.1	0.0	1	836	1	836
ALJ58617.1	0.0	1	836	1	836
QUT90272.1	0.0	1	836	1	836
QUT35459.1	0.0	1	836	1	836
QUT98069.1	0.0	1	836	1	836

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3X17_A	2.96e-32	18	586	7	551	Crystalstructure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium],3X17_B Crystal structure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium]
5U2O_A	4.71e-28	33	611	2	567	Crystalstructure of Zn-binding triple mutant of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]
5U0H_A	1.05e-24	33	611	2	567	Crystalstructure of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]
4CJ0_A	4.88e-22	22	606	27	563	ChainA, ENDOGLUCANASE D [Acetivibrio thermocellus],4CJ1_A Chain A, ENDOGLUCANASE D [Acetivibrio thermocellus]
1CLC_A	5.11e-22	22	606	41	577	ChainA, ENDOGLUCANASE CELD; EC: 3.2.1.4 [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C2S4	2.67e-21	22	606	27	563	Endoglucanase D (Fragment) OS=Acetivibrio thermocellus OX=1515 GN=celD PE=1 SV=1
A3DDN1	2.88e-21	22	606	51	587	Endoglucanase D OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celD PE=1 SV=1
A7LXT3	2.91e-20	25	591	32	578	Xyloglucan-specific endo-beta-1,4-glucanase BoGH9A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02649 PE=1 SV=1
P14090	1.94e-17	25	595	341	911	Endoglucanase C OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) OX=590998 GN=cenC PE=1 SV=2
P23658	6.50e-17	25	591	4	545	Cellodextrinase OS=Butyrivibrio fibrisolvens OX=831 GN=ced1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000236	0.999199	0.000153	0.000138	0.000128	0.000126

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002470_00027.