CAZyme Information: MGYG000002470_00462

Basic Information

• Species: Bacteroides intestinalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides intestinalis
• CAZyme ID: MGYG000002470_00462
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	MGYG000002470_1|CGC15	43121.38	7.1676

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002470	5774847	Isolate	Ireland	Europe

• Gene Location: Start: 627083; End: 628192 Strand: -

Full Sequence      

MKRLIIYFILSIVAIYSYGQNSFNKTDIKSIMKSVADWQIANPAKGNEHDDLNWTYAALY
MGMIDWAELTEKEDKDSSYYEWLMKIGRRNAWQVGKYMYHADHIAVGQVFLDMYQKYHDR
NMWLPTLARTEFVINHPSASTLELDYRNMASLERWSWCDALFMAPPVYAKMYMLTDDWKY
IEFMNREYKATYDYLFDKEEKLFYRDHRYFNQKEANGTKVFWGRGNGWVLGGLCEILQTL
PRNNMHRQFYQDLFITLSDRIIQLQGKDGYWHASLLDPDSYPSPETSATGFIVYALSYGV
NEGLLDKATFMPAIEKGWKALVKAVEKNGKLGYVQPIGADPKKVTREMTEVYGVGAFLLA
GNQIYKMAK

Enzyme Prediction     

No EC number prediction in MGYG000002470_00462.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	48	365	4.6e-83	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.34e-96	31	367	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.22e-47	20	360	8	349	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO70899.1	2.60e-283	1	369	1	369
QUT90811.1	5.86e-255	1	367	1	367
ALJ58171.1	9.72e-254	1	367	1	367
ALJ59360.1	1.63e-199	1	367	1	368
QUT89583.1	1.63e-199	1	367	1	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	6.07e-75	23	367	24	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	2.95e-57	38	360	44	367	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	2.59e-46	64	360	65	350	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
1NC5_A	1.27e-09	157	364	141	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	5.20e-09	157	364	131	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	1.64e-76	11	367	17	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	4.06e-74	23	367	31	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	3.46e-72	29	364	58	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O31521	1.81e-11	53	334	30	299	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	6.97e-09	157	364	141	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.007958	0.990086	0.000610	0.000477	0.000428	0.000432

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002470_00462.