CAZyme Information: MGYG000002470_01037

Basic Information

• Species: Bacteroides intestinalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides intestinalis
• CAZyme ID: MGYG000002470_01037
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
786	MGYG000002470_2|CGC3	87235.49	5.4131

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002470	5774847	Isolate	Ireland	Europe

• Gene Location: Start: 195906; End: 198266 Strand: -

Full Sequence      

MKRRIALCIAVSLCAGVYAGNNPGIYKKGWIDFNKNGVKDIYEDPSAPIEARVQDLLSQM
TLEEKTCQMATLYGSGRVLKDSLPTEKWKDEIWKDGIANIDEQANGLGRFGSSLSYPYVN
SVENRQTIQRWFVEQTRLGIPVDFTNEGIRGLCHDRATMFPAQCGQGATWNKELISEIAQ
VTAEEAKALGYTNIYSPILDIAQDPRWGRVVECYGEDPFLVGELGKRMIKGLQQEGLVAT
PKHFAVYSIPVGGRDAGTRTDPHVAPREMRTLYIEPFRKAFCEAGALGVMSSYNDYDGEP
ITGSYHFLTEILRHEWGFKGYVVSDSEAVEFLYSKHQVAVDAVDGAAQVVNAGLNVRTNF
TLPENFIRPLRQAISEGKVSMQTIDSRVADVLRVKFGMGLFDNPYKGDAKHPEKVVHSKE
HQAVSMRAALESIVLLKNENNVLPLSKDLKKIAVIGPNANEVQNLICRYGPANAPIKTVY
QGIKEYLPDAEVRYAKGTDIIDKYFPESELYEVPLDQEEQAMMDEAVALAEESDVAIMVL
GGNEKTVREEYSRTNLDLCGRQEKLLQAVYATGKPVILLLVDGRVATINWAERYIPGIVH
AWFPGEFMGDAVAQVLFGDYNPGGKLAVTFPRSVGQIPFAFPFKPGSDSKGFVRVTGTLY
PFGYGLSYTTFAYSDLKIENPVIGVQGSVKLSCKVKNTGKVAGDEVVQLYLHDEMSSVTT
YVKVLRGFERIHLEPGEEKVIDFVLTPQELGLWNKDNHFVVEPGTFAVMVGSSSQDIKLQ
GKFEVK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	134	356	6.3e-65	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	1	784	1	763	beta-glucosidase BglX.
PLN03080	PLN03080	1.21e-88	44	771	44	769	Probable beta-xylosidase; Provisional
COG1472	BglX	4.82e-83	60	490	1	394	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.18e-72	433	668	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	2.92e-62	61	394	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO69004.1	0.0	1	786	1	786
QUT88115.1	0.0	1	786	1	786
ALJ60867.1	0.0	1	786	1	786
QRQ47313.1	0.0	1	786	1	786
QUT46487.1	0.0	1	786	1	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	1.90e-143	53	786	14	752	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.05e-142	53	786	14	752	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5Z87_A	5.87e-142	36	778	30	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5YOT_A	7.26e-141	39	786	4	757	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	2.85e-140	39	786	4	757	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	4.34e-141	137	775	62	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	1.09e-131	50	785	35	764	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	6.45e-130	50	785	35	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	8.51e-123	42	786	29	755	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	5.04e-103	44	777	32	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000593	0.995684	0.003107	0.000216	0.000189	0.000172

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002470_01037.