CAZyme Information: MGYG000002470_01052

Basic Information

• Species: Bacteroides intestinalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides intestinalis
• CAZyme ID: MGYG000002470_01052
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
636	MGYG000002470_2|CGC3	73415.76	6.5908

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002470	5774847	Isolate	Ireland	Europe

• Gene Location: Start: 236753; End: 238663 Strand: -

Full Sequence      

MKKYLLIGLFLLGLFIYPIKAISGNTPEELYESLQKRLASGWNTWDTRSVLTHVFLPYGF
AVDLNMMDTDGSRVRKFRIGDRAKGAPLLQPGPHSFDGAYTKMTIDWRGYKLQVESAAIG
LKNVILIRPLAETKKGGRLVVIPESLWKRGNTLSVDSLGFTLASRDKVVEIKTYIEGELL
EKKGREFILSLDTPVAICCGENMELDEAIAFINDRARDFINSNQKKFGENYDCYNAMQSV
LAWDNIYDPGIRRVITPVSRIWSSEWFASEDFGGFTLFCWDTYFASMMLAVGNKELAYAN
AVEITKAITESGFVPNCFYSNNFKSRDRSQPPVGSLAVWTIYKQYQEKWFLELLYKELLT
WNRWWSRNREDGGLLCLGSNPYEKVTYFRSEFDTDCHYGAVLESGLDNSPMYDGVPFNKQ
KHLLEQHDVGMSSLYIMDCDYLALIAEELGYRKDVIELRKRAEYYRNNLAGLWDDKTGFY
YNRSTRDLKFNYRTSPTCFYPLLAKVPTKNQAERMIKEHLLNTDEFWGEYVIPSVPKNDP
AFKDNEYWRGRIWAPLNFLVYLGLNNYEFPEVRHAFAEKSQKLLLKSWLSHGYVFENYNA
LIGEGDDVVRSDKFYHWGALLGYIALIENGVVSKCN

Enzyme Prediction     

No EC number prediction in MGYG000002470_01052.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	274	621	2.4e-29	0.3543859649122807

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	7.59e-20	272	604	342	762	alpha-glucosidase; Provisional
pfam03200	Glyco_hydro_63	3.16e-08	350	621	187	488	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
pfam01204	Trehalase	1.91e-07	261	600	107	475	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG1626	TreA	3.38e-06	277	567	172	486	Neutral trehalase [Carbohydrate transport and metabolism].
COG3408	GDB1	2.13e-05	266	603	272	583	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68990.1	0.0	1	636	1	636
QRQ47302.1	0.0	1	636	1	636
QUT46474.1	0.0	1	636	1	636
ANH81205.1	1.40e-266	6	630	1	634
QNK58860.1	1.48e-177	31	630	18	616

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	1.76e-10	272	603	315	734	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	6.97e-10	272	603	315	734	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	9.17e-10	272	603	315	734	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	1.90e-08	272	603	316	735	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
4J5T_A	2.30e-07	501	621	664	796	Crystalstructure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	9.76e-10	272	603	338	757	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
P49381	1.51e-08	472	615	549	693	Cytosolic neutral trehalase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=NTH1 PE=1 SV=1
P52494	2.53e-07	472	603	704	838	Cytosolic neutral trehalase OS=Candida albicans OX=5476 GN=NTC1 PE=1 SV=1
P53008	1.27e-06	501	621	694	826	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
P32356	8.39e-06	472	611	547	681	Cytosolic neutral trehalase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NTH1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000432	0.998662	0.000289	0.000186	0.000197	0.000191

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002470_01052.