CAZyme Information: MGYG000002470_01503

Basic Information

• Species: Bacteroides intestinalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides intestinalis
• CAZyme ID: MGYG000002470_01503
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540	MGYG000002470_2|CGC8	61037.88	5.8184

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002470	5774847	Isolate	Ireland	Europe

• Gene Location: Start: 731078; End: 732700 Strand: +

Full Sequence      

MRNSKYLQILGICTLFSVTACSSKLEIPEPPVYNKVRNISVDLNQEMQTIDGFGASDAWR
CQMVGKYWPEEKRNQIADWLFSQEVDENGNPKGIGLSMWRFYIGAGSTEQGLDSDIADEW
RRSECFLSADGTYNWNKYEGQKWFLKAARDRGVEHFLAFNLSAPVHMSINGKGFSIKEKR
MNIKAGMMPDYADFLVECIDNLQKKEGIKFDYLSPVNEPQWDWSKGSQEGTPATNEEISQ
FVKLLSERLSKRGLATKIALGEAGSIQYLYKNVDNENFDNQIDDFWNPSSPLSIASLPNV
ERVMTGHSYWTVWPVKDLVSHRKALNDKIKEHSGLKYWQTEYSILESPGESEIPNGNGNK
RDLGMQTALFVARTIHNDLTLVNASSWSWWTALTRADYKDGLVYLDDGTNNGSQVTDYCK
KDGFARDSKLMWMLGNYSFFVRPGMKRVAVITENPDPEKEGKDVMISAYKDGSSQKIVLV
AVNVGSVNRKYNLQDLKLKNQTLTPYTTSETSNLGKGTTIKTNEIVVPAKSVVTFVGELE

Enzyme Prediction     

No EC number prediction in MGYG000002470_01503.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	38	536	2.3e-203	0.9958677685950413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	4.19e-174	39	404	4	367	O-Glycosyl hydrolase family 30.
COG5520	XynC	2.55e-18	20	540	13	431	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68591.1	0.0	1	540	1	540
QUT88592.1	0.0	1	540	1	540
ALJ60402.1	0.0	1	540	1	540
SCD20877.1	4.32e-270	9	540	10	543
APA00119.1	5.62e-237	5	537	2	539

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	1.91e-102	41	538	10	497	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6IUJ_A	1.97e-15	39	540	24	474	ChainA, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	2.44e-15	39	540	95	545	Crystalstructure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]
7O0E_A	5.63e-15	39	450	5	361	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	3.47e-14	39	450	12	368	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q1N4	6.17e-15	39	450	29	385	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000003	1.000047	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002470_01503.