CAZyme Information: MGYG000002470_01507

Basic Information

• Species: Bacteroides intestinalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides intestinalis
• CAZyme ID: MGYG000002470_01507
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
591	MGYG000002470_2|CGC8	68570.16	7.8157

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002470	5774847	Isolate	Ireland	Europe

• Gene Location: Start: 739979; End: 741754 Strand: +

Full Sequence      

MKYLYLLLCTLLGFDVMAQTGQSFEFTQIRQELQKKWPDNRTVNLVFHGHSVPSGYANTP
NVKTLQAYPHQVLEAVKEIYPYAVVNSITTSIGGENAEQGAKRFKQEVLPHRPDILFIDY
ALNDRSIGLERALKAWEKMIKEAQKQNIPIILLTPTPDLTEDILDDNSPLEQHSRQIRRL
AHDYKTGLIDSYATFKEKRKNGEDLKIYMSQSNHPNEKGHQVVTRLILNYFFEEAQWNEY
CQNQTMTIMKKIADWQLMNFENQVRKGSQWTNSHAYWAWTNATMYIGMAEWAEMSDDPKY
WNFLLTIGEKNQWQTGPSIYFADDICIIQPYAMLFNKYKEPRMIKKSVKTLDTLIANPRH
NSLSYYADGSHSRWCWCDALFMAPTSFARIGKITGEPKYFEFMDKEFQITYDSLYSVADS
LFFRDTRYINMREQNGKKVFWGRGNGWVTGALTFIIDNMPAQHPSRVFYISLFRQMLKKI
STLQDKQGFWHSSLLDTASYPMPETSASGFFTYSLFWGLNHGYLEKEEYLPIAKKAWNAL
ASVVHEDGKIGYVQPIGADPKKVDINDTEVYGTGAFLLAATEYVKYLKHTK

Enzyme Prediction     

No EC number prediction in MGYG000002470_01507.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	272	584	2.1e-84	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	8.68e-93	248	587	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	4.09e-57	242	585	2	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam13472	Lipase_GDSL_2	3.15e-15	47	222	1	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd00229	SGNH_hydrolase	3.39e-15	45	230	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
cd01834	SGNH_hydrolase_like_2	2.20e-14	44	228	3	189	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68587.1	0.0	1	591	1	591
QUT88594.1	0.0	1	589	1	589
ALJ60399.1	0.0	1	589	1	589
SCD20872.1	0.0	1	587	1	588
SDS10578.1	4.26e-111	249	591	40	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	3.33e-68	266	585	35	368	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	7.08e-56	279	588	56	376	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	2.97e-47	279	588	39	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
3K11_A	4.91e-15	441	587	264	414	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4WU0_A	2.16e-14	276	583	22	358	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF04	5.60e-74	248	588	60	413	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
T2KPL9	1.53e-73	261	585	35	374	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	2.22e-67	266	585	42	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000216	0.999175	0.000159	0.000143	0.000135	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002470_01507.