CAZyme Information: MGYG000002470_02204

Basic Information

• Species: Bacteroides intestinalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides intestinalis
• CAZyme ID: MGYG000002470_02204
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
468	MGYG000002470_3|CGC17	53182.81	6.9713

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002470	5774847	Isolate	Ireland	Europe

• Gene Location: Start: 664796; End: 666202 Strand: +

Full Sequence      

MNIKTFYLTGTLLLLSIGTYAQKKKETINDSNTPLHLLQPEYKVPYKALSTTEVKTDIDR
ILRYLEKTTHTRVVSEKTGKVITDYSNLPADAQLERGAFRLASYEWGVTYSAMMAAAEAT
GDAAYMKYVTDRFKFLAEVAPHFRNLLEKNGTTDPQMKQILTPHALDDAGAVCAAMIKAQ
LQDKSLNLYPLIDNYLDFILNKEYRLADGTFARIRPQLNTLWLDDMFMGVPPVAWYSRMA
DKEQSKYLAEAVRQIFQFAERMWVPEKKLFRHGWVEGMGDHPAFFWGRANGWALLTMTEV
LDVMPTNHPQREKLMNLFREHVRGLAALQSGEGFWHQLLDRNDSYLETSATAIYVYCISH
AINQGWLDAMAYGPVAQLGWHAVSTQINAEGQVEGTCVGTGMAFDPAFYYYRPVNVYAAH
GYGPVIWAGAEMINLLNKQHPKMNDSAIQYYRTEQKTQAPIFSVSKPD

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	99	433	4.9e-90	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.14e-86	104	436	29	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	5.73e-42	203	436	114	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO69320.1	0.0	1	468	1	468
ALJ61441.1	1.84e-315	1	465	1	465
QUT92984.1	1.84e-315	1	465	1	465
QUT85476.1	5.95e-292	1	464	1	465
AND18173.1	5.95e-292	1	464	1	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	1.16e-235	24	464	2	442	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	7.01e-24	104	432	41	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.85e-23	104	432	31	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	1.01e-21	190	415	132	360	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.26e-19	190	415	133	361	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.84e-23	104	432	41	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	4.92e-19	217	433	196	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O31521	6.76e-18	197	402	103	305	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.052530	0.861530	0.084774	0.000458	0.000334	0.000328

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002470_02204.