CAZyme Information: MGYG000002470_02812

Basic Information

• Species: Bacteroides intestinalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides intestinalis
• CAZyme ID: MGYG000002470_02812
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
859	MGYG000002470_4|CGC6	95400.3	6.8065

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002470	5774847	Isolate	Ireland	Europe

• Gene Location: Start: 469159; End: 471738 Strand: -

Full Sequence      

MQRKQLIFNIIVMVFLLGRVSLVPLQAQPYKNAKLSPELRAVDLLQRMNLEEKVAQIRHI
HSGHIFDGQMLNEEKLKDFVQDKCWGFVEGFPLTGESCHQHLHRIQEYMLKHTRLGIPIF
TIGESLHGSVHEGSVIYPQNIALAATFNPSLAYQKSAGISAELHYQGIRQVLGPCIDVVR
DMRWGRVEESYGEDPFLNAILACEEVRGYLDNGISPMLKHYGPHGNPTGGLNLASVHCGI
GELHDVYLYPFKRVITTLPIQAVMSTYNSWNRIPNSASYYLLTEVLRRRWGFGGYVYSDW
GAIDMLHTFHHTASTLSEAAVQALTAGLDVEASSECYPYLVPLIEQGKVDEALVDTAVYR
VLLAKFRIGLFENPYGKVVQADQLHVSENRQLARRIADESVVLLKNDGDLLPLVPSKLKS
IAVIGPNADQVQFGDYTWSRDNKDGVTPLAGIRSLLAGTGVQVRYAKGCSIMSLDTTNIA
AAVAAARASDVAVLFCGSASASLARNYREVNCGEGFDLTDLSLSGAQEKLIRDVHATGKP
LILVMVTGKPFSIPWEKKHVPTILVQWYAGEQGGNAVADILFGKTVPSGRLPVSFPQSAG
HLPAHYNYLPTDHGYYRQPGSYEVPGRDYVFSSPEPLWAFGHGLSYTVFDYEDMKIEQRE
DSIMLSVCIRNIGERAGQVVPQLYVRDLYSSVVTPVKQLKAFAKVFLKPKETIEVSLNVA
IQDLAFTNNQGKMVLESGDFELQVGDSSDKIFLRDTVQIGFQDTTYQVKETVLDTMNSCG
EAVITVKGIVRDTQATPIQGVNIFSTLQKKILVVTDKDGKYEIKVQSNDILIFHKKNYLE
EKIFVNGKPSIQITIRNGI

Enzyme Prediction     

No EC number prediction in MGYG000002470_02812.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	111	331	1.1e-59	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	6.47e-143	25	749	19	756	beta-glucosidase BglX.
COG1472	BglX	1.38e-82	48	471	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	2.72e-79	114	746	78	770	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	7.12e-56	50	362	2	314	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	1.35e-54	401	646	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO71585.1	0.0	13	859	1	847
QQA30647.1	0.0	20	858	19	857
QUT62191.1	0.0	20	858	19	857
QUT33795.1	0.0	20	858	19	857
BCI64332.1	0.0	11	858	20	871

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	2.05e-144	30	751	7	748	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	1.59e-143	30	751	7	748	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	2.00e-134	30	751	36	777	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	8.22e-110	44	748	17	741	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	4.38e-109	44	748	17	741	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	6.26e-112	30	751	24	757	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH0	1.16e-111	114	748	62	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	3.49e-110	30	751	24	757	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	5.70e-109	26	770	25	756	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	1.02e-82	45	746	43	763	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000195	0.999238	0.000142	0.000146	0.000131	0.000121

TMHMM  Annotations     

start	end
7	29