CAZyme Information: MGYG000002470_02815

Basic Information

• Species: Bacteroides intestinalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides intestinalis
• CAZyme ID: MGYG000002470_02815
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
611	MGYG000002470_4|CGC6	68992.81	6.9753

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002470	5774847	Isolate	Ireland	Europe

• Gene Location: Start: 474744; End: 476579 Strand: -

Full Sequence      

MKKLIILFFLFTSSLYAQTKLKMESVQIGGYVGGRIEDCIRTRVQLQDVDHLTAPFRTKN
DTASWQTEFWGKWVQGAIASYRYNHSVALYAKIKKSVDDIISTQQPDGYIGNYRLDAQLK
SWDIWGRKYTTLGLLSWYEISGEKQALNAACRVIDHLMTQVGEGGTNIVTTGNYYGMASS
SILEPVMYLYKYTGDYKYLQFAKYIVAQWETPEGPQLITKAINGVPVAARFPHPFDWFSP
ENGQKAYEMMSCYIGLLELYKVTHNAAYLDAVQKTVNDIANTEINVAGSGSAFESWYSGR
KYQTSPTYHTMETCVTFTWMQLCDKLLALTGNPFYADQIEKSLYNALMAALKDDASQIAK
YSPMEGHRCEGEEQCGMHINCCNANGPRAFALIPDFAVKKMGNEVYVNYYGDMSASLENG
HNKVLVKQHTTYPVSNVIDITIDVTKENVFGLHLRVPVWSAQTVITLNGEELKDICPGTY
HAITRKWKKGDHIQIILDMPARLLEQNQMQAIVRGPIVLARDSRFNDGFVDETLVVDSED
GIVKAEVDSVPGFAWMRLKVPVTVGTDLEGVGMYRNISFCDFASAGNTWDKQVRYRVWIP
RTLDVKKGHLK

Enzyme Prediction     

No EC number prediction in MGYG000002470_02815.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	49	519	6.8e-61	0.9293893129770993

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	8.04e-58	48	520	24	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.13e-57	20	535	11	515	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	7.50e-213	16	605	17	612
QHS51661.1	4.75e-38	72	522	123	582
QUT89696.1	4.55e-36	72	604	107	659
AII67299.1	5.95e-36	72	604	98	650
QJR78982.1	5.95e-36	72	604	98	650

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	4.86e-30	92	526	90	554	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	1.10e-23	92	518	97	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	6.79e-23	72	521	105	601	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QK0_A	1.36e-21	92	518	97	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6YQH_AAA	1.78e-17	242	520	259	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.24e-14	72	528	80	574	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001038	0.997886	0.000322	0.000250	0.000234	0.000227

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002470_02815.