CAZyme Information: MGYG000002470_04010

Basic Information

• Species: Bacteroides intestinalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides intestinalis
• CAZyme ID: MGYG000002470_04010
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
562	MGYG000002470_7|CGC6	63581.62	7.0377

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002470	5774847	Isolate	Ireland	Europe

• Gene Location: Start: 223752; End: 225440 Strand: +

Full Sequence      

MRNLKLKLLFALLFFSAFTTGKKDVITIFMIGDSTMANKSLKNGNLERGWGQMLPGFLTD
DVRVDNHAMNGRSSLSFINEGRWDTVLSKLKSGDYVFIQFGHNDEKSAEKLHTVPGSTFD
ENLRRFVRETRAKGAYPVLFNSIVRRNFPPEGATENKGSYEMEGNTLVDTHGEYLESPRR
VAKEMNVPFVDMNKLTHDLVVGMGVEKSRSLFMWVPAGKYDFCPKGKIDNTHLNIYGGKV
VAEIAMEAVAKVVPELAPYVRHHDSEVYVADYKDDKQCAVSYTLDDGLEEHYTLVFPEME
KVGFKGTFWIWGKGIENEAAQQGKTRMTWAQMKEMSDKGHEISSHSWSHANLKSLTLEEV
ETEVEKNDSIILAWIGKRPLTFCYPFNAYNEDILQISSKDRVGTRTKQYGIGGDKSKSTI
ESLDKWVKELAIAGEWGVAMIHGIATGYDAFTSPEILWEHFKRVKALEDNIWVGTYCEVA
AYVKERKNIQLDITKKKSSFKITPRLALDDKLFCEPLTMVVSKNGKSEIKVSQGKQELAV
KDAGDKFIFSFDPHGEVIKISF

Enzyme Prediction     

No EC number prediction in MGYG000002470_04010.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE12	27	248	3e-77	0.9904761904761905
CE4	275	398	6.1e-27	0.8615384615384616

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01821	Rhamnogalacturan_acetylesterase_like	1.77e-84	26	249	1	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
cd10970	CE4_DAC_u1_6s	9.34e-26	279	455	2	186	Putative catalytic NodB homology domain of uncharacterized prokaryotic polysaccharide deacetylases which consist of a 6-stranded beta/alpha barrel. This family contains uncharacterized prokaryotic polysaccharide deacetylases. Although their biological functions remain unknown, all members of the family contain a conserved domain with a 6-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10918	CE4_NodB_like_5s_6s	3.21e-24	283	396	5	123	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10967	CE4_GLA_like_6s	2.33e-22	278	466	1	202	Putative catalytic NodB homology domain of gellan lyase and similar proteins. This family is represented by the extracellular polysaccharide-degrading enzyme, gellan lyase (gellanase, EC 4.2.2.-), from Bacillus sp. The enzyme acts on gellan exolytically and releases a tetrasaccharide of glucuronyl-glucosyl-rhamnosyl-glucose with unsaturated glucuronic acid at the nonreducing terminus. The family also includes many uncharacterized prokaryotic polysaccharide deacetylases, which show high sequence similarity to Bacillus sp. gellan lyase. Although their biological functions remain unknown, all members of the family contain a conserved domain with a 6-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
pfam01522	Polysacc_deac_1	4.03e-19	280	399	9	118	Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyzes glucosidic bonds in xylan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO67467.1	0.0	1	562	1	562
QQY38016.1	0.0	1	562	1	565
ABR39821.1	0.0	1	562	1	565
QUT68402.1	0.0	1	562	1	565
QDM12561.1	0.0	3	562	2	562

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1DEO_A	8.78e-16	27	249	2	212	RHAMNOGALACTURONANACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.55 A RESOLUTION WITH SO4 IN THE ACTIVE SITE [Aspergillus aculeatus],1DEX_A RHAMNOGALACTURONAN ACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.9 A RESOLUTION [Aspergillus aculeatus],1K7C_A Rhamnogalacturonan acetylesterase with seven N-linked carbohydrate residues distributed at two N-glycosylation sites refined at 1.12 A resolution [Aspergillus aculeatus],1PP4_A The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus],1PP4_B The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus]
3C1U_A	4.00e-15	27	249	2	212	ChainA, Rhamnogalacturonan acetylesterase [Aspergillus aculeatus]
2O14_A	6.93e-15	27	247	164	357	X-RayCrystal Structure of Protein YXIM_BACsu from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR595 [Bacillus subtilis]
7FBW_A	2.47e-10	280	398	119	228	ChainA, Predicted xylanase/chitin deacetylase [Caldanaerobacter subterraneus subsp. tengcongensis MB4]
5LFZ_A	2.14e-08	280	389	27	126	T48deacetylase [Arthrobacter sp. AW19M34-1],5LGC_A T48 deacetylase with substrate [Arthrobacter sp. AW19M34-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31523	4.54e-37	23	249	3	212	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1
O31528	7.48e-24	28	256	5	205	Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) OX=224308 GN=yesY PE=1 SV=1
P42304	3.83e-16	27	247	179	372	Uncharacterized esterase YxiM OS=Bacillus subtilis (strain 168) OX=224308 GN=yxiM PE=1 SV=2
Q00017	6.46e-15	27	249	19	229	Rhamnogalacturonan acetylesterase OS=Aspergillus aculeatus OX=5053 GN=rha1 PE=1 SV=1
Q5BAA2	6.64e-14	27	249	19	224	Rhamnogalacturonan acetylesterase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN2528 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.029141	0.348697	0.621002	0.000451	0.000324	0.000374

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002470_04010.