CAZyme Information: MGYG000002470_04327

Basic Information

• Species: Bacteroides intestinalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides intestinalis
• CAZyme ID: MGYG000002470_04327
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
805	MGYG000002470_8|CGC3	91555.86	6.9148

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002470	5774847	Isolate	Ireland	Europe

• Gene Location: Start: 125031; End: 127448 Strand: -

Full Sequence      

MKKKWILLLLITISFTNLAAQDALYPNTFPLGDVRITAGPFKHACDLNVKVLLQYDTDRL
LAPFLREAGLPKKAETYGNWEKDGLDGHIGGHYLSALAIHYAATGNQECKKRMDYMVSEF
ARVQQANDDGSICGFPNSKKFAEEIRKGNVGIVWNYWVAWYNMHKTYAGLRDAWLYGKNE
KAKKIFLKFCDWGVDVISNLDDRQMERMLDNEFGGMNEVYADAWQMTGNPKYLDTAKRFS
HKQIFDSMTRRIDNLDNKHANTQVPKAVGYQRVAELNSKTASDYNEFMTAAEFFWETVVF
HRSLSLGGNSRGEHFPEAGKCSDYMHERQGPESCNTNNMLKLTEGLFRIHPKVEYADFYE
RALYNHILSTQHPEHGGYVYFTPACPSHYRVYSAPGEAMWCCVGTGMENHGKYGQFIYTH
DTVDNALYVNLFIPSELNWKEKKIKIVQETDFPNEEGTTLTVNPSKATQFKLLIRYPSWV
EQGKMQVGCDGVDYAKNAQPGSYIAIDRQWSKGDVVEIKTPMTVRIEELPNVPNAISIMR
GPILLGARTGTENMPGLIAGDGRWEHIAHGSLVSLFDVPYIIGERSDILNKLNRMKPVEG
KSFSFTVPGLFTQEKYKNLILEPFYGIHDSRYMMYWLSMPEPAFREYKQAVEAEENGRMI
LDKRTVDMVSSGEQQPESDHAMKTQDSHRGVHAGEAWRDARNGGYFEYTLTTKGNENLSL
MVRYWGAESGSRSFDILVDGQTIATENIVGKWKKDLFCNVEYNIPATLLKSKDKITVRFQ
SKSDTTAGGIFAVRLLVPESTVTDK

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	33	545	3.3e-196	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.07e-167	33	545	1	502	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.08e-105	20	545	3	500	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	7.38e-38	550	636	1	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68314.1	0.0	1	805	1	805
QUT88913.1	0.0	1	805	1	805
ALJ60078.1	0.0	1	805	1	805
ADY37333.1	0.0	3	796	2	795
QCD36520.1	0.0	14	799	16	788

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	4.83e-215	5	796	6	801	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	2.00e-208	5	796	6	801	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	2.61e-21	270	544	273	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	9.80e-20	270	544	273	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	1.09e-19	211	544	243	605	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000315	0.998983	0.000198	0.000166	0.000158	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002470_04327.