CAZyme Information: MGYG000002470_04500

Basic Information

• Species: Bacteroides intestinalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides intestinalis
• CAZyme ID: MGYG000002470_04500
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000002470_8|CGC6	42854.27	7.7389

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002470	5774847	Isolate	Ireland	Europe

• Gene Location: Start: 380422; End: 381525 Strand: +

Full Sequence      

MCKKSLLLLFLLPFQLVFAQTSLLTDFPEGYTPKEVGKRLAYHFVDGKHMLHIGKWISYP
ETFTWNGGLKFAALTNDQELVKLLQNRFELLFTTEKALLPIKNHVDVNMFGSLPLELYKI
TKDQRYLDLGLPYADTQWQLPENAKPKEKEWDQKGYSWQTRLWIDDMYMITIVQTQAYRV
TGDRKYIDRAAREMVMYLDELQCPNGLFYHAPDVPFYWGRGNGWMAAGMAELLSSLPEDS
EYRPRILHGYRTMMKSLKKYQSSNGLWHQLLDHPDCWIETSGSAMFTFAFIKGVKNGWLD
AKEYAPAARKAWMAMVKYIDENNNVKSVCEGTNKKNDKQYYYDRKQNVGDYHGQAPYLWC
AVALLEE

Enzyme Prediction     

No EC number prediction in MGYG000002470_04500.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	57	364	5.8e-76	0.9548192771084337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.51e-51	59	362	29	337	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	3.72e-44	59	358	36	347	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68160.1	8.07e-286	1	367	1	367
QUT89086.1	7.43e-282	1	367	1	367
ALJ59889.1	7.43e-282	1	367	1	367
BCA52191.1	5.28e-218	1	367	1	367
QUT73021.1	5.28e-218	1	367	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	3.08e-37	58	359	81	405	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	2.87e-29	67	358	49	358	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.23e-28	67	358	39	348	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
5NOA_A	1.20e-24	106	312	110	321	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	3.18e-21	163	312	141	304	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.57e-28	67	358	49	358	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
O31521	1.76e-19	65	349	31	324	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
T2KPL9	2.12e-18	213	325	225	339	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	7.19e-18	217	325	231	340	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	2.52e-16	163	325	201	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000198	0.999236	0.000153	0.000148	0.000139	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002470_04500.