CAZyme Information: MGYG000002470_04541

Basic Information

• Species: Bacteroides intestinalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides intestinalis
• CAZyme ID: MGYG000002470_04541
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	MGYG000002470_9|CGC2	36704.16	7.0128

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002470	5774847	Isolate	Ireland	Europe

• Gene Location: Start: 45746; End: 46708 Strand: -

Full Sequence      

MAWLSGSLSYPDGGQAGRKLQKDDETLVYDHPGDVLLLKEGDRHPKVDSWYFYTAHEFNG
KDTKKGLPLGFIEHRGMHMSRTAKVDNRKCSKVEDGVLCIWSVEEKDSIDNRFGKKVKYS
HGCYRTSLPGSKEFWCNFTENMRIEIRFKRTSYVGFNDALWFMGNNNRPWPKNGEIDLLE
NPKKTLNDRAHFTLHSENHYAGVVGGSGSVTSTIDLADMSQWNIYWLEWYPDRIVGGVNG
QAYFEHNKGADGNTDWPWSDPQGFFLIFSTGISTNPNAWPGAIIPSEWKKDAMPAMYIDW
IRVYTNKDYKGENPPAPKFY

Enzyme Prediction     

No EC number prediction in MGYG000002470_04541.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	85	304	2.6e-27	0.8565217391304348

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	4.27e-26	91	304	40	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	1.48e-07	143	304	69	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
COG2273	BglS	1.95e-05	93	304	78	263	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
cd02182	GH16_Strep_laminarinase_like	2.71e-05	159	305	110	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
pfam00722	Glyco_hydro_16	5.21e-04	143	302	35	168	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89376.1	1.33e-218	10	320	496	806
ALJ59588.1	7.60e-218	10	320	496	806
QBJ17909.1	1.86e-173	22	320	627	925
QNE41958.1	9.12e-17	46	310	44	286
EAR00020.1	1.85e-16	34	304	32	295

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XOF_A	4.10e-14	92	307	71	269	ChainA, GH16 family protein [uncultured bacterium]
6XQF_A	1.92e-13	92	307	71	269	ChainA, GH16 family protein [uncultured bacterium],6XQG_A Chain A, GH16 family protein [uncultured bacterium],6XQH_A Chain A, GH16 family protein [uncultured bacterium],6XQL_A Chain A, GH16 family protein [uncultured bacterium],6XQM_A Chain A, GH16 family protein [uncultured bacterium]
6T2N_AAA	4.29e-13	50	309	52	307	ChainAAA, Glycoside hydrolase family 16 protein [Akkermansia muciniphila],6T2N_BBB Chain BBB, Glycoside hydrolase family 16 protein [Akkermansia muciniphila]
6T2O_AAA	8.24e-09	85	303	72	272	ChainAAA, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2O_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185]
6T2P_AAA	2.00e-08	85	303	72	272	ChainAAA, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2P_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2Q_AAA Chain AAA, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2Q_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002470_04541.