CAZyme Information: MGYG000002471_01454

Basic Information

• Species: Yersinia mollaretii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Yersinia; Yersinia mollaretii
• CAZyme ID: MGYG000002471_01454
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide core heptosyltransferase RfaQ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385	MGYG000002471_2|CGC7	43085.6	6.8858

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002471	4663229	Isolate	Finland	Europe

• Gene Location: Start: 410829; End: 411986 Strand: -

Full Sequence      

MMNASNKTESPAGQLPAPAHSGIHLPEILREKENVKRILVIKLRHFGDVLLTTPLLSTLK
ANYPQAKIDVLLYGGTQEMLRENSAVNHAFIVDRGLKHAGFTAQISGEKALFTALKAHHY
DLILNLSDQWRAAAYCRLLKPGFSIGFHYPKRDTWLWRYCHSALVEIPHAAERHTVLNNL
DILAPLQLTDIITDVTMSYGPQDIERVKQLCQQRNIHDYLLIQPSARWKFKTWASESFSQ
LINHLTEQGETVLLTGGKDQAELDYIAEIIAGCAQPEKVINLAGLLALPELAVLIDNAKL
FIGVDSVAMHMAAALQTPAVVLFGPSNLNQWHPWQAPHTLLWAGHYRTLPLPNEIDTETT
DRYLNAIPVNEVIEAVDAWRVAKGH

Enzyme Prediction     

No EC number prediction in MGYG000002471_01454.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	110	344	8.7e-51	0.8977777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02201	heptsyl_trn_III	8.17e-116	37	377	1	340	lipopolysaccharide heptosyltransferase III, putative. This family consists of examples of the putative ADP-heptose:LPS heptosyltransferase III, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. This enzyme may be less widely distributed than heptosyltransferases I and II. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10422	PRK10422	1.15e-90	31	377	1	340	lipopolysaccharide core biosynthesis protein; Provisional
COG0859	RfaF	8.16e-71	35	383	1	333	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	2.54e-59	37	378	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	4.78e-41	110	367	3	247	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKJ03018.1	1.51e-281	1	385	1	385
AKP34182.1	2.18e-270	1	383	1	383
QKJ07033.1	2.74e-266	1	385	1	386
QDW34821.1	3.20e-265	1	385	1	386
ATM88567.1	2.93e-261	1	385	1	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	3.80e-12	36	377	9	342	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
2GT1_A	7.92e-12	37	327	2	283	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	7.92e-12	37	327	2	283	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	8.35e-12	37	327	2	283	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]
1PSW_A	1.25e-10	37	327	2	291	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25742	2.86e-73	43	377	1	328	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q9R9D5	2.83e-72	43	377	1	328	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P26469	8.65e-13	37	327	2	283	Lipopolysaccharide heptosyltransferase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaC PE=3 SV=2
P37692	2.65e-12	37	327	2	291	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P37421	6.39e-12	37	327	2	291	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002471_01454.