CAZyme Information: MGYG000002472_00478

Basic Information

• Species: Lentilactobacillus kefiri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lentilactobacillus; Lentilactobacillus kefiri
• CAZyme ID: MGYG000002472_00478
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
271	MGYG000002472_1|CGC3	29367.28	9.2622

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002472	2568073	Isolate	Italy	Europe

• Gene Location: Start: 459264; End: 460079 Strand: -

Full Sequence      

MEVFGIFKQIKNGLTKAIIAVAAITGFCFVTAHVSSASVETDFINQLKEPVVKVSRANHL
YPSVMMAQAIVESDFGQSELSLDANNYFGVKGAYNGQSVTMSTGEYTTKGKHYMTAAAFK
KYPTVVASIKDNAYLLRHGTLTDPDYYAGTWTTNATSSADAAMALSLTYATDMNYGNKLN
AIITKYDLNKLDGSASSGDIHSKIDASLNKQLAGKKDNSAVEAESSQSKINSIPKRIIPN
FVFNDKGATKINQGDSVIQFNSLPLERIIRK

Enzyme Prediction     

No EC number prediction in MGYG000002472_00478.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	51	188	9.5e-28	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	4.73e-44	30	198	34	194	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK06347	PRK06347	1.60e-40	31	235	142	337	1,4-beta-N-acetylmuramoylhydrolase.
PRK08581	PRK08581	7.79e-38	41	192	321	472	amidase domain-containing protein.
smart00047	LYZ2	6.14e-28	42	193	10	145	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	1.13e-19	48	131	1	76	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGV25979.1	3.87e-178	14	271	1	258
AFS00453.1	1.52e-150	14	271	1	259
QUX05738.1	8.79e-150	14	271	1	259
AEB73548.1	4.90e-149	16	271	2	258
APR08225.1	3.26e-145	14	271	1	259

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.58e-35	32	192	22	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	7.14e-26	43	192	63	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	1.36e-30	41	199	181	340	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
A2RHZ5	4.56e-30	43	199	65	221	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	1.67e-29	43	199	65	221	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
Q9CIT4	2.36e-29	43	202	65	224	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P39046	4.90e-29	43	196	65	218	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.144997	0.851129	0.002811	0.000337	0.000327	0.000368

TMHMM  Annotations     

start	end
13	35