CAZyme Information: MGYG000002473_00700

Basic Information

• Species: Victivallis vadensis
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis vadensis
• CAZyme ID: MGYG000002473_00700
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
562	MGYG000002473_12|CGC2	63132.9	10.0168

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002473	4576885	Isolate	not provided	not provided

• Gene Location: Start: 44762; End: 46450 Strand: +

Full Sequence      

MLLKIFDSRRLPVTLLILFYLATYILPLGSRQMIRPDEFRYAEIPREMLASGNWITPKLV
DVRYFEKPALGYQLTALSFKYFGENAFALRLPSALAVGITALLLFRLLKTNSSDPRLPVL
ATGIYLLCGLVYGVGTFAVLDSQLTAALTLTIGFFYFAWSARTRLATAAWLAAVGAATGA
AFLLKGLLAFAVPTVVIVPFLLWQKEWKKIFVYPWLPFAAALLVALPWALAIHHQEPDFW
RYFIEEEHFNRFTGNTYDRDPEPFWYFIPVLLGGMLPAGLYCTAAWMGWKRELFRRPLYR
FLLCWAVLPFLLFSASSCKLGTYILPCFPPLAALIAAGTLEAFRLRPGSARKILDITFKS
LGLLLAALAVIATVGLIVWRFIPALPELYGKWNLFPYLTLLALLAWGVALIRSRRWTAPV
QSAVFLFGMAPAIVFGLNAVPDIALGDKATAVGIRQCLEEIPVRRGDIILVDRGTLQATA
WLLKRTDLVLIGKPGELQYGLNNYPEYASRWYKEEETDKLLAASHPGSRLFITLRNLKKK
PLPPDWAAEQVVTRNGISVIRF

Enzyme Prediction     

No EC number prediction in MGYG000002473_00700.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	10	517	2e-108	0.924074074074074

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	3.54e-121	8	523	3	509	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	3.35e-47	1	520	1	516	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam02366	PMT	3.25e-13	13	243	5	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	6.44e-08	67	228	2	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSH42095.1	1.87e-116	16	548	8	539
AVM46372.1	2.26e-114	19	540	10	531
AVM46371.1	2.88e-95	15	556	8	550
CBX27700.1	1.26e-91	20	539	16	536
QSH42096.1	3.06e-90	9	521	2	503

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.08e-34	13	506	34	519	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4ETL9	2.36e-86	8	562	6	549	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1
C5BDQ8	3.23e-86	14	556	9	541	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
B7VBN0	1.88e-83	8	510	2	489	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=arnT PE=3 SV=1
Q3KCB9	5.18e-83	8	506	2	485	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT2 PE=3 SV=1
Q02R27	7.27e-83	8	510	2	489	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	34
86	108
117	139
143	160
165	182
186	203
210	232
264	286
298	315
320	339
360	382
392	411
423	445