CAZyme Information: MGYG000002473_00721

Basic Information

• Species: Victivallis vadensis
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis vadensis
• CAZyme ID: MGYG000002473_00721
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
746		84519.8	6.5025

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002473	4576885	Isolate	not provided	not provided

• Gene Location: Start: 23126; End: 25366 Strand: -

Full Sequence      

MQNCNIRLGFWIAAPGKKRGYEVDTRENAPVFRREFEVSNSFQNGRILICGLGFYELYLN
GHKVGDRVLDPVPSNYLTRINYAVYDVTAYLKPGRNTVGVILGNGWYNPNTKDEWCFWAA
SWRDCPKMTLKLELDGREVLCSDESWRVGESPITFNALRNGEFYDARLEMPGWCTNGFDD
TKWPPAMRIAPPGGDLEQELQPPCKVLATFIARPTEKFNVYDAGRNLAGWARIFVEGEAG
AEIILRYAERLTPAGELSVEYQDMYIHSGEFQTDRYILKGSGTEIWEPRFTYHGFRYIEA
KIRGRAKIHKIEAREVGTAFKTAGEIVTSDSTLNRLQSMTLNSYRSNYVGIPTDCPHREK
SGWTCDVMLAAETGLFNFEAASGYRGWLRILGDLQRRSGQLPALAPTGGFGFNWGSGPAW
DSVLFSLPYDLYLHTGDDGAIREHYDGMKRYLGFCEFMATDHILFFGLGDWCPPDWEKIC
PAQITSTGYYYRDAKYLAKFAQLLGNKADEIRYTVLADSIAQAFHRRFHLGGGRYGTGNG
IGEFTATGCALYHGLVPEKEKFGALEFLIEYAEKTEYACDFGILGAKYIPRVLAENGRAD
LALRFFTQRQFPGWAHWIDLGMTTLGEMWNGTSSRNHIMYGDISAWMFRYLGGFRHSWEQ
PGKRYLEIQPMPVVSACRSEYCRYLSDWRINGDEFEIDITVPQGGAGLLVMPDGSRHILS
SGSARFRCIVDLTFSPVLRSHSELLT

Enzyme Prediction     

No EC number prediction in MGYG000002473_00721.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	219	706	2.7e-124	0.9722222222222222
CBM67	11	194	1.4e-37	0.9659090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.80e-85	321	651	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.20e-57	46	206	7	170	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	9.71e-27	220	299	9	83	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	7.53e-04	660	714	6	66	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
PRK10340	ebgA	8.11e-04	31	100	112	175	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44981.1	3.54e-232	1	728	20	758
AVM44977.1	1.46e-210	29	704	17	696
QGQ94103.1	7.55e-195	11	722	127	852
AHF16194.1	2.53e-188	9	729	139	883
AYB33152.1	2.01e-179	19	723	174	889

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	3.47e-134	29	712	176	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.57e-86	33	702	306	985	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.31e-76	19	729	121	868	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	3.19e-100	29	745	184	940	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	2.03e-96	11	726	153	893	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	1.19e-85	33	702	306	985	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	7.99e-63	33	702	174	869	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002473_00721.