CAZyme Information: MGYG000002473_00728

Basic Information

• Species: Victivallis vadensis
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis vadensis
• CAZyme ID: MGYG000002473_00728
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
597		67524.94	5.1457

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002473	4576885	Isolate	not provided	not provided

• Gene Location: Start: 34528; End: 36321 Strand: +

Full Sequence      

MDFQTPWFDFRLTGLADGWTCDYTCRRETEDVCIAGFQFRNVQPGRLPACRLEFRIPWRD
MQIKWMPRRNMTDCHHFFPGWWNGGKFPYAVTHNQLLYVFANEAGQNRLAFACSECCRAV
LATCGVSGEYIECELFFNTTASDPASGFSFELKFDRRELAYDRVLADLAEWQARQYAPAP
IPETAFLPVYSTWYQFQKDVSQAELEKELPEAAAAGLKNIIIDDGWQCAGNGGGDDMSST
GEWLPDQTKFPDLAAFSERCGEYGVGCLLWVGLPFVGKKCAAVYEKFRGKYLLENDSFAI
LDPRFPEVRRHLVGVCRRLVSDYGLAGLKLDFIDQVHLLGRKDPMGEDAAGRDFRSLEKA
LDRLLDEIHSELCSLRKDVLIEFRQFYSGPSIRQYCNILRAQDCPGDEFQNRMRTVDLRL
TAAPAAVHADMMTWHPAEKVPVILRQLLNTLFSVPQISVRLADAPEEVRRALAGYLNFTQ
EYRELLQKGRLSASHPEHCYPVVSSTLGDEMLIAVYADGQVIEPPRGLGCVVVVNASWWD
GVFLRVQSSVAVKIFDIFGSPLREETLSPGIREIAVPSTGYALLTPDGADRHFISER

Enzyme Prediction     

No EC number prediction in MGYG000002473_00728.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	162	517	3.9e-32	0.5232558139534884

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	3.78e-48	185	481	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	1.97e-12	188	332	3	151	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG3345	GalA	1.60e-07	178	286	291	389	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam02065	Melibiase	5.54e-07	189	331	44	190	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14792	GH27	2.04e-06	190	252	5	66	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46636.1	0.0	1	597	1	598
AVM46708.1	2.32e-108	43	580	43	581
QTH41069.1	5.36e-105	10	591	12	595
QJD86820.1	1.32e-104	48	586	47	602
BBI31507.1	4.05e-104	10	580	9	588

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000022	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002473_00728.