CAZyme Information: MGYG000002473_00922

Basic Information

• Species: Victivallis vadensis
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis vadensis
• CAZyme ID: MGYG000002473_00922
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1142		125332.19	8.3606

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002473	4576885	Isolate	not provided	not provided

• Gene Location: Start: 4480; End: 7908 Strand: +

Full Sequence      

MKTFILLAVSVVALACAGEEIRFDGSVAVALIQGEKRDQALTPAVPSESEAPCLKLTWGE
RRHRFAELKLRNNRKIAPVEQASAGLTVYVPEKTRVGRIGVRFTDAKGETFQFYPAGEGL
KRGAWNTLSYRISETDANSSWGGNADRKVDGALRFSGVAVNFPAGSGAGELFIGKLQLHE
RQGELLVCGEPFLNFDRSENFALRGNPAEASLKLTDSGWEMAGTVEKRKKFTMVDRKLSL
TPYAPAELAVFRLDGAGSTGKGTAALSYTDSTGRKFQAKCNFAPGQKELRFEFPASKAPT
GYYSSITVEPEPGEFRLCFTGSERFGRRSAAEAVGFEVDTGNPLHLLLAGEKGKPAFRFI
NRAAVPLEVQAEVELVDYYGRSVKNAFPLKLAPGEAVSRPLEGTLPALGIWYVSCRITAA
NDKGDVAVSKRSFAWLKPAGPTPGRAKGFLFGICSHPQRWSLRDQELEALAMAYCGGKVL
RNDASWSSLQPAPDRWNFESMDRKVELFGRYDIELAPIWAYTPRWAAAPEVRGKEWKEWF
RSLPDYGAWEKFISATVTRYRGKIRLWEVWNEPDFKGRTSYGSDEYAELMKLAWRAAKAA
DPEVIIQSGGFATVKDHPSRKGNFHEEALVKGRGFFDIHAYHEHGRFASYRAAVEERFLP
MRERTGTTVPWYANETALNSLGGERNQAAALFKKLLYSWANGAIGYNWYDLRNDGFDVKN
GEHNYGMITNDFQPKAVYVAYNTLAGCFSGAQYLKRIDCKAPELYVYLFSRGGELLAGIW
NETNRGATVPLQFSTDAAAAEAVDLMGNARPLAVQGGIVVAEAGRDPVILRLKKASDCIW
GGNLVSIDTDGPAVPGSKVKLAIGVRNPYAQEREFRLKLIVPEGVAAVPAERVIRIAAGS
EASWNSELSIPVTYRKAAELQLEYAIGADGASGVIGLPLVPARRIASGEMKPEAPDFRMD
RRDQAISLFEADPGKVHLTWQGPEDRSARVWLRRDGTQLRLRFAVTDDRHVQPNSGAGVW
KGDCVQFALLLPGQDRMWEIGLSRLDSGKSEVFIWSAPSGFDVAGSAAGIRLATSREGTV
TCYDATIPLSVLGTTPEALAAGARFNALINDDDGEGREGWIQIAPGIGENKDPAKYPLIL
FP

Enzyme Prediction     

No EC number prediction in MGYG000002473_00922.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	495	761	4.8e-25	0.6751740139211136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	8.72e-78	955	1141	1	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	1.58e-12	979	1126	29	175	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
COG3693	XynA	1.02e-11	453	603	39	186	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
cd00241	DOMON_like	1.67e-08	978	1121	10	156	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
smart00633	Glyco_10	2.40e-08	486	605	3	124	Glycosyl hydrolase family 10.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM47149.1	7.08e-254	54	1141	214	1306
AVM46276.1	3.18e-233	65	1141	56	1136
AVM44759.1	3.02e-216	191	1141	23	964
AHF94342.1	3.47e-173	338	1141	219	1032
AHF90198.1	1.72e-167	290	1141	154	1005

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MRJ_A	5.06e-06	446	602	102	255	Crystalstructure of Endo-1,4-beta-xylanase-like protein from Acremonium chrysogenum [Acremonium chrysogenum ATCC 11550],5MRJ_B Crystal structure of Endo-1,4-beta-xylanase-like protein from Acremonium chrysogenum [Acremonium chrysogenum ATCC 11550]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q60041	7.67e-06	452	606	37	191	Endo-1,4-beta-xylanase B OS=Thermotoga neapolitana OX=2337 GN=xynB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000383	0.998864	0.000279	0.000169	0.000148	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002473_00922.