CAZyme Information: MGYG000002473_00935

Basic Information

• Species: Victivallis vadensis
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis vadensis
• CAZyme ID: MGYG000002473_00935
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1319		146875.13	8.0464

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002473	4576885	Isolate	not provided	not provided

• Gene Location: Start: 23506; End: 27465 Strand: +

Full Sequence      

MVQRISYASMLLFAAIPWCGSIIAAGENVSMPSSGWMWMEARPEEHCTRYFRYAFELPGR
VKAAPVWFAVDDLGTIYVNGTLLTSRQGIPPKKYELAKLLRPGRNVIAVKAENRIGLAGV
IFRGMAVLENGGVFPLVSSRDMRCSREASGDWTGGGYDDREWKRTFRLGPAAMKPWGRLV
NIGPLQGGEAVPEEQPSFWYWHEEKPQNNTHRYFRVNLELEDDAASAPVWIACDDEADIS
VNGTVIARRHGWRARRFNLGSRLKAGRNVIAFDVRNGRPPAGVIFRGEIMLKNGTVIPLA
SNGNVLSSAEAPENWRLPEFDDSGWRQANRVGAADMKPWSKLTDMTMFLPAMPPPAVPAT
PGRLLLDDFADISSWLGGPGEGGRPGATHPFDFSFGSVPDSRREDGWAGALCFDTARPGG
EARFSKNSIYQMPMAPSAVLFSADAAGHAGGVSFAFLDRFDRTFTTSEVRIGGEGWRDYR
LELNEKTIPEFRKIAFPVRLSRIAYRNDEPAAGRVLIDDLFCEADVSRPERQLEVHPDYR
KLCFDVGEPAGMTFRVRNALPESVNGSFELKVFDMDRKELVSRRATLELGKFGFGRVDFD
LGTFSRKGGYAVELTVGNGRVKHVYQGWLGVMRPNGSRINKLPMWFGLEDQEINTAPYEA
GFHVEWMKLLGADMIRGGFSGNRAERERGSTAGYEAFRRMWRPHTEAGLDICLDYAGGIP
AWTAGSGKSPAGVIRPHNCDPALFREHIGRVAEFVASMPRIKWFEWFNEPNLGWRMPNEA
YMEGLRLLYPILKERAPEVAVGTGGLVIGAHPKARPGFIRETYVDNAASYDIALFHAHDG
LSNYRKYTQEVIRLTGGTKRFANTETGYRSYHGKPELFYRQAGVLVRKMAYSRAVGMEFY
VWFMVQDYWDKYINADDSFGLITVDNQPKPSCVAYNELVRQLANTVPAPGGGLDPRLESY
RFRGGGEEVFAAWPKQDGAVFSFCLKSTAPVRMVDIFGNENVLEPVRGIVYVNTPQLPFY
LRAPEGAVSSVGELVRIAGNPVYAPGEKRPVELELCNPYQEKIQYALSCNGEKVTGTLSA
AAGRKVRLATLSPASVKPGPFTLPVAVELKNTESRILYRGNLKLQACMALPVGMRGQAYP
VRLDSEAVLTELAFDPTTPRWSGKEDLSAEIRLSRTATALVFDIDVRDQNHCTPFRQAMN
WSNDSIQVGLADRSGAHREFTFSDGPDGEPIAWCHHSPVETEVGKAGLPLTVARRDGVTH
YHFEIPFHRLGIRPQKGELFRMALLVNDNDGGKRLRVMEYFGGIEGGKNIDFFGWCILN

Enzyme Prediction     

No EC number prediction in MGYG000002473_00935.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM67	199	339	1.7e-23	0.9829545454545454
CBM67	36	176	2.2e-19	0.9829545454545454

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	4.85e-42	1140	1318	2	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	1.83e-09	1161	1292	30	163	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	7.32e-05	1152	1294	3	152	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46501.1	0.0	196	1318	28	1153
AHF92778.1	5.81e-275	180	1319	20	1178
AVM46714.1	6.36e-199	343	1314	6	964
AVM46712.1	2.12e-166	361	1314	73	1007
AVM46271.1	7.82e-147	363	1318	22	965

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	1.92e-10	155	345	97	298	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
2OKX_A	7.34e-06	199	342	10	190	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.05e-09	155	345	97	298	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.143645	0.829908	0.023125	0.001429	0.000701	0.001157

TMHMM  Annotations     

start	end
7	29