CAZyme Information: MGYG000002473_01299

Basic Information

• Species: Victivallis vadensis
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis vadensis
• CAZyme ID: MGYG000002473_01299
• CAZy Family: GH63
• CAZyme Description: Cytoplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
537		61185.37	5.5103

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002473	4576885	Isolate	not provided	not provided

• Gene Location: Start: 22788; End: 24401 Strand: -

Full Sequence      

MAHQPILNVWGGGQLLGFSAFDGETDYDSGLVLRTVADCCGFEIKLPVESGIVLPDAEPP
RACMLAGDHFQLECSSGPVRGAFADARHFIIDGECRVYGLNDALQIIRRPGRTVLGVRKG
FNESWLDADFDAIFRQRAAWLAKLPQPGLPTDEARRTYWKACSQLKTQLNSPSGCLKHRW
TTPDRWPHRKMWLWDSVFHAQGLRRLDPAVARETLEAVFDGQCADGFIPHMASPHEKSDI
TQPPILGYGIKLMLEQQQSPEFLERLYPKNAAFLNWIFAHRDTDGAGLVEWAIEAHEMCR
SGESGMDNSTRFDGATQLDAPDFNAYLASECEIMAEFAALLGRPEEQKLWQERHRKLNHL
MNERLWNDAAGLYVDYDLAAGKQSPVLSLAGFLPLISGAPTAEMAEKLVRNLKNPETFGT
PFPVPSISFSQPEFYSKDMWRGPVWININTLIARGLDRYGYRDEARQLRSRTMRELEKFY
CRYGTFFEFYDDRNECDPPELLRKFRCDPDRSVYHQAFMDYGWSATLYIDLAFTMYS

Enzyme Prediction     

No EC number prediction in MGYG000002473_01299.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	150	493	7.4e-43	0.4

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	1.03e-34	151	468	303	735	alpha-glucosidase; Provisional
pfam03200	Glyco_hydro_63	6.25e-23	193	494	94	472	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
pfam01204	Trehalase	6.20e-21	303	491	275	474	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG3408	GDB1	1.51e-16	192	491	285	579	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
COG1626	TreA	3.59e-16	300	491	323	518	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44395.1	2.51e-208	1	531	1	526
AHF91275.1	8.38e-179	5	530	66	589
QTE69242.1	9.19e-86	7	533	4	546
BBH87153.1	2.56e-54	120	532	182	573
BAL98738.1	6.37e-54	118	532	190	583

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WVA_A	8.10e-27	181	491	21	396	Crystalstructure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVA_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVB_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVB_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVC_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8],4WVC_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8]
3W7S_A	3.60e-25	151	477	276	717	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7W_A	3.60e-25	151	477	276	717	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
2Z07_A	4.11e-25	181	491	21	396	Crystalstructure of uncharacterized conserved protein from Thermus thermophilus HB8 [Thermus thermophilus],2Z07_B Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8 [Thermus thermophilus]
3W7X_A	1.51e-24	151	477	276	717	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D8QTR2	6.66e-26	160	490	72	461	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	2.20e-25	160	490	72	461	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
P42592	2.03e-24	151	477	299	740	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
P94250	6.93e-11	308	476	170	332	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
Q9W2M2	2.11e-07	190	457	196	507	Trehalase OS=Drosophila melanogaster OX=7227 GN=Treh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000086	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002473_01299.