CAZyme Information: MGYG000002473_01447

Basic Information

• Species: Victivallis vadensis
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis vadensis
• CAZyme ID: MGYG000002473_01447
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345		39026.85	5.1612

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002473	4576885	Isolate	not provided	not provided

• Gene Location: Start: 12402; End: 13439 Strand: +

Full Sequence      

MSIEKFSISRDPELYEAWPDAALAADGRLVCVFSECTHHGNRDYTRIMLADSFDRGRTWT
PKRPLTEGTRNRDYYYNCARITRLRDGRLAVSVDKMPLNGESRTREAVNLLYFSSDNGRS
WSAPAPVPLRGIVPDKLLELENGRWIYSAHREDGGNLAQFLCYSDDSGKTWSDDVTVARS
DRFQLCEASILPLGGGVLAAFLRENSGLGYDCKKVLSRDNGESWGEITDFPLPGCHRPVA
GFLRDGRIMITYRFLQGGRGWLGSWCQNFFAALTDRESVLSEKREEASARILPVDFDRSP
KSDLGYSGWVQFPDGELYIVNYIVDDAMDKGQIRGYSMFPDEFLL

Enzyme Prediction     

No EC number prediction in MGYG000002473_01447.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	25	240	1.5e-23	0.6754385964912281

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	3.23e-27	21	320	18	321	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	1.12e-19	27	252	1	227	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	0.001	25	184	120	264	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	0.008	5	91	226	320	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44758.1	2.55e-184	3	345	2	345
AYB46154.1	1.28e-139	1	345	1	342
ANY72719.1	2.67e-139	1	345	1	342
AHF91127.1	3.15e-127	3	345	2	357
AHF89372.1	5.80e-88	3	345	2	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BF6_A	9.39e-07	108	252	189	365	AtomicResolution Structure of the bacterial sialidase NanI from Clostridium perfringens in complex with alpha-Sialic Acid (Neu5Ac). [Clostridium perfringens]
2VK5_A	9.43e-07	108	252	189	365	TheStructure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK6_A The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK7_A The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK7_B The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens]
5TSP_A	9.54e-07	108	252	190	366	Crystalstructure of the catalytic domain of Clostridium perfringens neuraminidase (NanI) in complex with a CHES [Clostridium perfringens ATCC 13124],5TSP_B Crystal structure of the catalytic domain of Clostridium perfringens neuraminidase (NanI) in complex with a CHES [Clostridium perfringens ATCC 13124]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002473_01447.