CAZyme Information: MGYG000002473_01686

Basic Information

• Species: Victivallis vadensis
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis vadensis
• CAZyme ID: MGYG000002473_01686
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
618		69508.68	8.3569

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002473	4576885	Isolate	not provided	not provided

• Gene Location: Start: 15048; End: 16904 Strand: +

Full Sequence      

MKKTWSCLAAAAAGLSLSAAPAVIQDPYGVCAHVSRGEWQFAPQTFQKMHEAGINWVRTD
FDWKYSEPKQGSWNYSHLDRVIELAKKEKINVLPILDYDVPWATPAWKHLDLWSGYVRNL
VNRYPLLRYWEVWNEQNSPSFWHDASSGENYAKLLERTYREIKAINPEITVLYGGTAGVP
LPFIEASLKAGAGNYFDVMNIHPYHWRGVPEMMFSDLSSLRALMRKYGVGEKPVWITEVG
WATAQPPRFYLDVLPSVLAEAGVKPADSMVAIVNDPELGFFEAPNFNADFNLGMFRKVDR
IRLADLKSLDVKKYPVLVPSTSEEFPMAYLPDVVAYVKRGGTLVLPSGLPFYHDFQMDGK
GGGKLVQVNDKYLKDLHIGWETWWVNKAVPSQEKWQKAAPRFAGKFKVDFKPTGRFLTAA
NLKKGDEFIPVIEAGTDDYKGTVCGLYKFNSDLTGNIIVYSGLGVIDSTTEKRQAEMLPR
TYLIALANGVQRVFWYNFRAGEWKPDEREHHFGIVHADFSPKPAFLAYKTLTSMCPAGST
VPVISTHGKVYLAGWTRPDKVKVWAVWTAESVQKISLRITGKAQALNHLGEAKSVPAGEY
AASPELLYLVGPEQVEVH

Enzyme Prediction     

No EC number prediction in MGYG000002473_01686.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	69	243	1.7e-28	0.4918793503480278

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	7.53e-10	46	281	30	293	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
pfam02449	Glyco_hydro_42	4.50e-08	33	166	6	169	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
pfam01229	Glyco_hydro_39	1.35e-06	35	262	31	299	Glycosyl hydrolases family 39.
COG3867	GanB	6.36e-05	46	242	69	286	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
COG1874	GanA	8.87e-04	28	93	18	85	Beta-galactosidase GanA [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44885.1	8.96e-297	8	615	9	614
QDU57372.1	1.19e-114	26	581	28	589
AVM44901.1	5.14e-65	12	533	12	547
AHF90941.1	3.37e-52	11	571	210	806
ADE82856.1	8.40e-38	24	617	34	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	1.55e-15	29	241	107	343	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]
4ZN2_A	1.08e-14	41	254	30	266	Glycosylhydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_B Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_C Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_D Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5BX9_A	1.08e-14	41	254	30	266	Structureof PslG from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5BXA_A Structure of PslG from Pseudomonas aeruginosa in complex with mannose [Pseudomonas aeruginosa PAO1]
1W91_A	4.30e-08	89	238	118	278	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
2BS9_A	4.30e-08	89	238	118	278	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZFM2	7.76e-08	89	238	118	280	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000402	0.998838	0.000227	0.000176	0.000164	0.000160

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002473_01686.