CAZyme Information: MGYG000002473_01818

Basic Information

• Species: Victivallis vadensis
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; Victivallis; Victivallis vadensis
• CAZyme ID: MGYG000002473_01818
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1132		127303.88	7.9684

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002473	4576885	Isolate	not provided	not provided

• Gene Location: Start: 14072; End: 17470 Strand: -

Full Sequence      

MKYRFGFWLGMTLCFSLWAAELADFGVAKTWMYQAEERGQSAARAADGGTVLRWDGQRAG
YAELFLAEPVPVPGKGEGIFRLKYRNLSEPAALRSINLRLRDQKGEMFQWKQRPGEKNGA
LSFDVSADNFSDCWGGNGRPELPLEVAGLGFDFAAGSGVGAIEPGRLTFEAGRHLRFPAR
EVWRSFGEDELWQLQAYRGRVHAVEEADSLTVDAAAEIVILRDRGLQLETFGRPREMRFR
VRLDSGEAQFAPELRDSTGKVRLLPKQRLKQGENELRFPLREALREFSGLVSVECLKLFL
PSRQARVTLEQAELSRELTPAEAVRFRVETGNGVRVLKLGEERALAVTFTNTLTDRPVEL
AAGLEIMDYHGRCKVLEKTLRLLPGERRCLPLDWKPERFGWHRIRCTLSDRSVPEEKRQV
SNSFAYLKPAGPTPGRAEGFLFGVCSHPERWGKRVRELEAEAAGLCGAKVMRDDTEWNLI
QPEPGIWNYSLFDHIVEAFGKRGIELNAILAYSPLWARDRERFPRQDAWRAFVRRTVERY
RNRIRFWEVWNEPDLPGFAPFGSDRYVEMLKNAYTEIKQAAPEAVVLTGGFATSVTLPQM
LADPDRQKRILAEGRGSYQVHAFHGHGDFPYFAQLVDLNLLPMRRKLGVTEPWYANETAL
TSTEGGERKQAETLFKKLFHAWSRGSIGYNWYDLRDDGYSRTDGEHNYGMLTHDFLPKPV
YAVYNMLAGTFSGAEFLRQEQVAGAKNLWLFTFRSGNTLLLPGWSENSGYGCRPVAVRTD
ARRAERIDLMGNIEPLPLVNGLLLFEIGPEPATLRLIEAHKSEIAGCPVQLAGGGLAVPG
REYPVTVLLENPLGTAADFEVALTAPAGLEFQGETLRRFRLEAGEKRRWNCVAVTGRTFR
AAGQEPAVIRLRYAVSGTPWKGEESLTVRAAVAIPAADRPDRKPDFRLDRVGQVQSFFRN
DPAMSHLVWKGPEDLSAEIRLAADAEALELSVAVRDDIHVQPFRGAAVWQGDNVQIGLAF
PNQRGFWEIGLSRLEDGTSEVFIWRAAYGFAPAVVAKQFRLIAERKGTVTTYQAKLPFRA
LGITPETAQSGFRFNLVVNDNDGGGRESFMRIASGLAEYKQPELFPYVMVVE

Enzyme Prediction     

No EC number prediction in MGYG000002473_01818.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	2.47e-73	944	1129	1	187	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	1.94e-15	968	1106	29	165	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	3.98e-10	961	1110	4	156	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
pfam06452	CBM9_1	2.81e-05	973	1110	29	160	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.
pfam02449	Glyco_hydro_42	3.68e-05	445	577	1	165	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM47149.1	4.05e-253	43	1129	207	1305
AVM46276.1	7.59e-228	42	1129	37	1135
AVM44759.1	1.88e-184	178	1129	19	963
AHF90198.1	1.88e-172	324	1128	193	1003
AHF94342.1	4.42e-165	291	1129	183	1031

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	1.44e-19	443	833	107	513	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]
4ZN2_A	2.65e-08	448	766	32	382	Glycosylhydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_B Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_C Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_D Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5BX9_A	2.65e-08	448	766	32	382	Structureof PslG from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5BXA_A Structure of PslG from Pseudomonas aeruginosa in complex with mannose [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.012718	0.960672	0.025572	0.000323	0.000322	0.000341

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002473_01818.